KEGG   Burkholderia thailandensis 2002721643: BG87_482Help
Entry
BG87_482          CDS       T03882                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00071  Fatty acid degradation
bthl00072  Synthesis and degradation of ketone bodies
bthl00280  Valine, leucine and isoleucine degradation
bthl00310  Lysine degradation
bthl00362  Benzoate degradation
bthl00380  Tryptophan metabolism
bthl00620  Pyruvate metabolism
bthl00630  Glyoxylate and dicarboxylate metabolism
bthl00640  Propanoate metabolism
bthl00650  Butanoate metabolism
bthl00900  Terpenoid backbone biosynthesis
bthl01100  Metabolic pathways
bthl01110  Biosynthesis of secondary metabolites
bthl01120  Microbial metabolism in diverse environments
bthl01130  Biosynthesis of antibiotics
bthl01200  Carbon metabolism
bthl01212  Fatty acid metabolism
bthl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG87_482
   00630 Glyoxylate and dicarboxylate metabolism
    BG87_482
   00640 Propanoate metabolism
    BG87_482
   00650 Butanoate metabolism
    BG87_482
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG87_482
   00072 Synthesis and degradation of ketone bodies
    BG87_482
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG87_482
   00310 Lysine degradation
    BG87_482
   00380 Tryptophan metabolism
    BG87_482
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG87_482
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG87_482
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG87_482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthl04147]
    BG87_482
Enzymes [BR:bthl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG87_482
Exosome [BR:bthl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG87_482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJY00530
Position
I:complement(548784..549989)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTSAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSDMAIGGGVESM
SRVPMGASGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAT
QAGWFARSIVPVRDANGLTILDRDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGAAAVLIGSLEAGKRAGLAPRARVRSFASVGSEPSMMLTG
PAYAAEKALKRAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgat
cgcaacggcctcgacacgagcgccgtcgacgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcagggcgcgtgcatcggccgcatcgcggtgctcgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcgtcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggacatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggcgcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctacttcgtgccgcagggcgtgtcggccgacacgatcgcgacgaagtggggctac
agccgagccgacgtcgacgcgtacgcagccgagagccaccgccgcgcgcacgcggcgacg
caggccggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcgcgacgaaacgatccgcccgcagacgacacccgagacgctcgcgacgctcaag
ccgtcgttcgccgaactgggcgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgagcgcatcgagcacgtgcatcacgcgggcaacagctcggggatcgtcgac
ggcgcggcggccgtgctgatcggctcgctcgaggcaggcaagcgcgcgggcctcgcgccg
cgcgcgcgggtccgctcgttcgcgagcgtcggctcggagccgtcgatgatgctgacgggg
ccggcctacgcggccgagaaggcattgaagcgtgccggcatgcgcgcggccgacatcgat
ctgtacgagctgaacgaagcgttcgcatcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgacaggatcaacgtgaacggcggcgcgatcgcgatgggccacccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgaactcgagcggcgcggcgcggcc
acgggcctcgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system