KEGG   Burkholderia thailandensis 2002721643: BG87_4930Help
Entry
BG87_4930         CDS       T03882                                 

Gene name
acnD
Definition
(GenBank) 2-methylisocitrate dehydratase, Fe/S-dependent
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00640  Propanoate metabolism
bthl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BG87_4930 (acnD)
Enzymes [BR:bthl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BG87_4930 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AJY02014
Position
II:complement(1982379..1984973)
Genome map
AA seq 864 aa AA seqDB search
MNTANRKPLPGTPLDYFDARAAVDAIRPGAYDTLPYTSRVLAENLVRRCDPAILADSLTQ
LIERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIAERGGDPAKVNPVVPVQLIVDH
SLAVECGGFDPDAFAKNRAIEDRRNEDRFHFIEWTKKAFENVDVIPPGNGIMHQINLEKM
SPVIQAQDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGV
ELTGKRQPGITATDVVLALTEFLRKEKVVGAYLEFRGEGAKSLTLGDRATISNMAPEYGA
TAAMFFIDEQTIDYLRLTGRSDEQVKLVETYAKAAGLWADSLANAQYERTLTFDLSSVVR
NMAGPSNPHRRLPTSDLAARGIAGKWEEKPGEMPDGAVIIAAITSCTNTSNPRNVIAAAL
LARNANARGLARKPWVKSSLAPGSKAVELYLKEANLLPELEKLGFGIVAFACTTCNGMSG
ALDPKIQQEIVDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDALGHDKDGKPVTLKDIWPTDEEIDAIVASSVKPEQFRTVYEPMFARRADAGERAAPLY
DWRPQSTYIRRPPYWEGALAGERTLAGMRALAVLGDNITTDHLSPSNAILPTSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPTLVNEMAVVDGEVKKGSLARVEPEGKVMRM
WEAIETYMNRKQPLVVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMG
VLPLEFKPGVNRTTLAIDGTETFDVIGERTPRADLTLVIRRRNGERVEVPVTCRLDTAEE
VSIYDAGGVLQRFAQDFLESSKAA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccaaccgcaaacccctgcccggcacgccgctcgattacttcgacgcgcgc
gccgccgtcgacgcgatccgcccgggcgcgtacgacaccctgccgtacacgtcgcgcgtg
ctcgccgagaacctcgtgcgccggtgcgacccggcgatcctcgccgattcgctgacgcag
ctcatcgagcgcaagcgcgagcgcgatttcccgtggttcccggcgcgcgtcgtctgccac
gacatcctcggccagaccgcgctcgtcgatctcgcgggcctgcgcgacgcgatcgccgaa
cgcggcggcgatccggcgaaggtgaatccggtcgtgccggtgcaactgatcgtcgaccat
tcgctcgccgtcgaatgcggcggcttcgatccggacgcgttcgcgaagaaccgcgcgatc
gaggatcgccgcaacgaggatcgcttccacttcatcgagtggacgaagaaggcgttcgag
aacgtcgacgtgatcccgcccggcaacggcatcatgcaccagatcaatctggagaagatg
tcgcccgtgatccaggcgcaggacggcgtcgcgtacccggacacctgcgtcggcaccgac
agccacacgccgcacgtcgacgcgctcggcgtgatcgcgatcggcgtgggcgggctggag
gcggagaacgtgatgctcggccgcgcgtcgtggatgcggctgccggacatcgtcggcgtc
gagctgaccggcaagcgccagcccggcatcaccgcgaccgacgtcgtgctcgcgctcacc
gaattcctgcgcaaggagaaggtggtcggcgcgtatctggaatttcgcggcgagggcgcg
aagagcctcacgctcggcgatcgcgcgacgatctcgaacatggcccccgaatacggcgcg
acggccgcgatgttcttcatcgacgagcagacgatcgactacctgcgcttgacgggccgc
agcgacgagcaggtgaagctcgtcgagacgtacgcgaaggcggcgggcctgtgggccgac
agcctcgcgaacgcgcaatacgagcgcacgctgacgttcgatctgtcgagcgtcgtgcgc
aacatggccggcccgtcgaatccgcaccggcggctgccgacgtcggacctcgccgcgcgc
gggatcgccggcaagtgggaagagaagccgggcgagatgcccgacggcgcggtgatcatc
gccgcgatcacgagctgcacgaacacgagcaacccgcgcaacgtgatcgccgcggcgctg
ctcgcgcgcaacgcgaacgcgcgcggcctcgcgcgcaagccgtgggtgaagagctcgctc
gcgcccggctcgaaggcggtcgagctgtacctgaaggaagcgaacctgctgccggagctg
gagaagctcggcttcggcatcgtcgcgttcgcgtgcacgacctgcaacggaatgtccggc
gcgctcgacccgaagatccagcaggagatcgtcgatcgcgacctgtacgcgacggccgtg
ctgtccggcaaccgcaacttcgacggccgcatccacccgtacgcgaagcaggcgttcctc
gcgtcgccgccgctcgtcgtcgcgtacgcgatcgcgggcacgatccgcttcgacatcgag
aaggacgcgctcggccacgacaaggacggcaagcccgtcacactgaaggacatctggccg
accgacgaggagatcgacgcgatcgtcgcgtcgagcgtgaagcccgagcagttccgcacc
gtctacgagccgatgttcgcgcgtcgcgccgatgccggcgagcgcgcggcgccgctgtac
gactggcggccgcagagcacgtacattcgccgtccgccctactgggaaggcgcgctcgcg
ggcgagcgcacgctcgcgggcatgcgcgcgctcgccgtgctcggcgacaacatcacgacc
gatcacctgtcgccgtcgaacgcgatcctgccgacgagcgcggcgggcgaatacctcgcg
aagatgggcctgcccgaggaggacttcaactcgtacgcgacgcaccgcggcgatcacctg
accgcgcagcgcgcgacgttcgcgaacccgacgctcgtcaacgagatggcggtcgtcgac
ggcgaagtaaagaagggctcgctcgcgcgcgtggagccggaaggcaaggtcatgcggatg
tgggaggcgatcgagacctacatgaaccgcaagcagccgctcgtcgtgatcgcgggcgcg
gattacggccagggctcgtcgcgcgactgggcggcgaagggcgtgcggctcgcgggcgtc
gaggcgatcgtcgcggagggcttcgagcggattcatcgcacgaacctgatcggcatgggc
gtgctgccgctcgagttcaagccgggcgtgaaccgcacgacgctcgcgatcgacggcacc
gagacgttcgacgtgatcggcgagcgcacgccgcgcgccgacctgacgctcgtgatccgc
cgcaggaacggcgagcgcgtcgaggtgccggtcacgtgccggctcgatacggccgaggaa
gtgtcgatttacgacgcgggcggcgtgctgcagcgcttcgcgcaggactttctcgaatcg
tcgaaggcggcgtga

DBGET integrated database retrieval system