KEGG   Burkholderia thailandensis 2002721643: BG87_5541Help
Entry
BG87_5541         CDS       T03882                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00430  Taurine and hypotaurine metabolism
bthl00620  Pyruvate metabolism
bthl00640  Propanoate metabolism
bthl00680  Methane metabolism
bthl01100  Metabolic pathways
bthl01120  Microbial metabolism in diverse environments
bthl01200  Carbon metabolism
Module
bthl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG87_5541 (ackA)
   00640 Propanoate metabolism
    BG87_5541 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BG87_5541 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BG87_5541 (ackA)
Enzymes [BR:bthl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BG87_5541 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase UBA_2
Motif
Other DBs
NCBI-ProteinID: AJY00956
Position
II:complement(2713191..2714369)
Genome map
AA seq 392 aa AA seqDB search
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRTPLQLEYSNSGDAHTVPLAA
SVTDDLHDVLDEALNWIGAHLPVHELVSVGHRVVHGGDAFGGPVRIDERTLDAIAALVPL
APLHQPQSVRLIRALRHLRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDEGVKRYGFH
GLSYRYVAGRLRERHPAVARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGVPMATR
CGTLDAGVVLHLQKTLGYSVDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALAL
FAFRIAGEAARLATTLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDADANARNAE
IVSSDASRVAVLVVPTDEEQVIARDAASVLHA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgctgctgctcacgttcaatgccggctcgtcgacgctgaagatcggcctc
tacagcgtcgcgaacggcgagcccgcgccgctcgggcgcggcaagatcgacttcaaccgc
acgccgctgcagctcgaatactcgaacagcggcgacgcgcacacggtgccgctcgccgcg
agcgtcaccgacgatctgcacgacgtgctcgacgaggcgctcaactggatcggcgcgcat
ctgccggtgcacgagctggtgtcggtggggcaccgcgtcgtgcacggcggcgacgcgttc
ggcgggccggtgcgcatcgacgagcgcacgctcgacgcgatcgcggcgctcgtgccgctc
gcgccgctgcatcagccgcagagcgttcggctgattcgcgcgctgcgccacctgcggccg
catctgccgcaggtggcgtcgttcgacaccgcattccaccgcacgcagtccgatctcgtg
cggcgcttcgcgctgccgcgcgcgctgttcgacgaaggcgtcaaacgctacggctttcat
gggctgtcgtaccggtacgtcgccgggcggctgcgcgagcggcatccggcggtggcgcgc
ggcaaggtcgtcgccgcgcatctcggcagcggcgcgagcctctgcgcgctcgacgcgggc
gtgagccgcgacaccagcatgggcttctcgacgctcgacggcgttccgatggcgacgcgc
tgcggcacgctcgacgcgggcgtcgtgctgcacctgcagaagacgctcggctactcggtc
gacgacgtcgagcagatgctgtatcaccgctcgggcttgctcggcgtgtccggcgtgagc
ggcgacgcgcgcgcgctgctcgccgatccgtcggccggcgcgcgcgatgcgctcgcgctg
ttcgcgttccggatcgcgggcgaggcggcgcggctcgcgacgacgctcggcgggctcgac
gcgctcgtgttcaccgcgggcatcggcgagcatcagccgcaaacgcgcgccgcggtgtgc
gagcggctgcgctggctcggcgtcgaactcgacgcggacgcgaacgcgcgcaatgcggag
atcgtgagcagcgacgcaagccgcgtcgcggtgctcgtcgtgccgaccgacgaagagcag
gtgatcgcgcgggatgcggcgtcggttctgcatgcgtga

DBGET integrated database retrieval system