KEGG   Burkholderia thailandensis 2002721643: BG87_5585Help
Entry
BG87_5585         CDS       T03882                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00010  Glycolysis / Gluconeogenesis
bthl00071  Fatty acid degradation
bthl00350  Tyrosine metabolism
bthl00625  Chloroalkane and chloroalkene degradation
bthl00626  Naphthalene degradation
bthl01100  Metabolic pathways
bthl01110  Biosynthesis of secondary metabolites
bthl01120  Microbial metabolism in diverse environments
bthl01130  Biosynthesis of antibiotics
bthl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG87_5585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG87_5585
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BG87_5585
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BG87_5585
   00626 Naphthalene degradation
    BG87_5585
Enzymes [BR:bthl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BG87_5585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AJY02557
Position
II:2758075..2759061
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGGAPRLREAELPDPVPGAGQLLIDVHACGVCRTDLHVVDGDLRDPKRPVIPGH
EIVGTVAALGAGAEGFAIGERVGVPWLGHTCGHCAYCASGRENLCDAPGFTGYTIDGGYA
QRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGAARRIGLYGFGAAAHLVAQG
ARFQGRTVYAFTRAGDAAAQQLARRLGAAWAGGSDEAAPEPLDAALIFASVGALVPAALA
AVVKGGIVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRDDAAEFMRIANDVQLDVEAT
PYPLAQANQALDDLRAGRLTGAAVLTMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtcttcgacggcggcgcgccgcggctgcgcgaagccgagttgccggac
cccgtgccgggggcggggcaactgttgatcgacgtgcacgcgtgcggcgtgtgccggacc
gatctgcacgtcgtcgacggcgatctgcgcgatccgaagcggcccgtgatcccggggcac
gagatcgtcggcacggtcgccgcgctcggcgcgggcgcggagggcttcgcgatcggcgag
cgcgtcggcgtgccgtggctcggccacacgtgcggccactgcgcgtactgcgcgagcggc
cgcgagaacctgtgcgacgcgcccggcttcaccggctacacgatcgacggcggctacgcg
cagcgcacggtcgccgacgcacgcttctgcgtgcacgtgccgagccgctacgacgacatc
catgcggccccgctgctgtgcgcgggcctcatcggctaccggacgctgaagatggcgggc
gccgcgcgccgcatcggcctgtacggattcggcgcggccgcgcacctcgtcgcgcagggc
gcgcgctttcaggggcgcaccgtctacgcgttcacgcgagcgggcgacgccgccgcgcag
cagctcgcgcgccggctcggcgccgcatgggcgggcggcagcgacgaagccgcgcccgag
ccgctcgacgcggcgctgatcttcgcgtccgtcggcgcgctcgtgccggccgcgctcgcg
gcggtcgtgaagggcggcatcgtcgtgtgcggcgggattcacatgtcggacatcccgtcg
ttttcgtacgacttgttgtggggggagcggcggatcgtgtcggtcgcgaacctgacgcgc
gacgacgcagcggaattcatgcgaattgcgaacgacgttcaactcgacgtggaggccacg
ccgtatccgctcgcgcaggcgaaccaggcgctcgacgatctgcgtgccgggcgtctgacg
ggcgcggcggtgctgacgatgcgctga

DBGET integrated database retrieval system