KEGG   Burkholderia thailandensis 2002721643: BG87_959Help
Entry
BG87_959          CDS       T03882                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00361  Chlorocyclohexane and chlorobenzene degradation
bthl00625  Chloroalkane and chloroalkene degradation
bthl01100  Metabolic pathways
bthl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BG87_959
   00361 Chlorocyclohexane and chlorobenzene degradation
    BG87_959
Enzymes [BR:bthl01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BG87_959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AJX97904
Position
I:1062576..1063199
Genome map
AA seq 207 aa AA seqDB search
MTIKAVVFDFGGVLIDWSPEYLYKQLIPDEAERRWFLMHVCGMDWVVRQDGGQTIDEGTD
ERIAQFPEHEALIRAFYARWREMIGGELAGGVALVDELDARGVPLFGLTNWSAQTFPYAW
ETFPVLRRFKDIVVSGRVKLVKPDPAIYREMHARIEPHLPGVAPHELAFIDDNAKNAAAA
TALGWHGIHHTSAEATQARLRELGVLG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaggctgtggtgttcgatttcggcggcgtgctgatcgactggagccccgag
tatctgtacaagcaactgattcccgatgaagccgagcggcgctggttcctcatgcacgtg
tgcggaatggactgggtggtcaggcaggacggcggccagaccatcgacgagggaaccgac
gagcgcatcgcgcagtttcccgagcacgaggcgctgatccgcgcgttctacgcgcgctgg
cgggagatgatcggcggcgagctcgcgggcggcgtcgcgctcgtcgacgagctcgacgcg
cgcggcgtgccgctcttcgggcttacgaactggtccgcgcagacgtttccgtatgcgtgg
gagacctttccggtgctgcggcgcttcaaggacatcgtcgtgtccggccgcgtgaagctc
gtgaagcccgatccagcgatctaccgcgagatgcacgcgcggatcgagccgcacctgccg
ggcgtcgcgccgcacgagctcgccttcatcgacgacaacgcgaagaacgccgcagccgcg
accgcgctcggctggcacgggattcaccacacgagcgccgaggcgacgcaggcgcggctg
cgcgagctgggcgtgctcggctga

DBGET integrated database retrieval system