KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_2219Help
Entry
BTRA_2219         CDS       T03391                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00071  Fatty acid degradation
bthm00072  Synthesis and degradation of ketone bodies
bthm00280  Valine, leucine and isoleucine degradation
bthm00310  Lysine degradation
bthm00362  Benzoate degradation
bthm00380  Tryptophan metabolism
bthm00620  Pyruvate metabolism
bthm00630  Glyoxylate and dicarboxylate metabolism
bthm00640  Propanoate metabolism
bthm00650  Butanoate metabolism
bthm00900  Terpenoid backbone biosynthesis
bthm01100  Metabolic pathways
bthm01110  Biosynthesis of secondary metabolites
bthm01120  Microbial metabolism in diverse environments
bthm01130  Biosynthesis of antibiotics
bthm01200  Carbon metabolism
bthm01212  Fatty acid metabolism
bthm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTRA_2219
   00630 Glyoxylate and dicarboxylate metabolism
    BTRA_2219
   00640 Propanoate metabolism
    BTRA_2219
   00650 Butanoate metabolism
    BTRA_2219
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTRA_2219
   00072 Synthesis and degradation of ketone bodies
    BTRA_2219
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTRA_2219
   00310 Lysine degradation
    BTRA_2219
   00380 Tryptophan metabolism
    BTRA_2219
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTRA_2219
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTRA_2219
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTRA_2219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthm04147]
    BTRA_2219
Enzymes [BR:bthm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTRA_2219
Exosome [BR:bthm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTRA_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AIC88217
Position
1:2433518..2434702
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGVAQHAPALTLNRLCGSGLQAIVSAAQGVLLGDADIAVAGGAENM
SRAPYAVPSARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKEQILPIEIASRKGAVVFDADEHVRHDASLDDFTKLKPVFVKEN
GTVTAGNASGINDAAAAVVLMERSVAEKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNELGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcaccgcgatcggcgatttcggcggc
agcctgaaggatttcgcgccgaccgagctcggtgcgcgcgtggtgcgcgaggtgttgtcg
cgcgcgcaggtgtcgggcgacgaagtcggccacgtcgtgttcggcaacgtcgtgcacacg
gaaccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggtggcgtcgcgcagcac
gcgccggcgctgacgctcaaccggctgtgcggctcgggcctgcaggcgatcgtgtcggcc
gcgcagggcgtgctgctcggcgatgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtatgcggtgccgtccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggcggagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcgcaccggcgcgcgtcgcatgcgacgaagtccggctacttcaaggagcagatc
ctgccgatcgagatcgcgtcgcgcaagggcgcggtggtgttcgacgccgacgaacacgtg
cgccacgacgcgtcgctcgacgatttcacgaagctcaagcccgtgttcgtcaaggagaac
ggcacggtgacggcgggcaatgcatcgggcatcaacgatgcggccgccgcggtcgtgctg
atggagcgcagcgtcgccgagaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcatgcgggcgtcgatccggcgtacatgggcatcggtcccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcacggtcgccgatctcgacgtgatcgaggcaaacgaggcg
tttgccgcgcaggcgtgcgcggtgtcgaacgagctcggcctcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggtcatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctctacgagctgcagcgcatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggtatcgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system