KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_3213Help
Entry
BTRA_3213         CDS       T03391                                 

Definition
(GenBank) class II Aldolase and Adducin N-terminal domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00051  Fructose and mannose metabolism
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTRA_3213
Enzymes [BR:bthm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BTRA_3213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AIC88203
Position
1:3574351..3575133
Genome map
AA seq 260 aa AA seqDB search
MVDTLKMGKAELVALAQRRLDNEIKDSGWTAREKLALTCRILFDDGHDSGLAGQITCRAD
TPNTYYTQRLGLGFDEIAESNLLQVNQDLEVIVGQGIPNPANRFHTWIYRARPDVNCIIH
THPAHVAALSMLETPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISNALGAKRAIL
LSHHGQLVVGKTIEEACMLAILIERAARLQLLAMAAGAIEPIPPALATDARDWISTPKRD
AVTFAYYARRALRHHPDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctc
gacaacgaaatcaaggacagcggatggaccgcgcgcgaaaagctcgcgctcacgtgccgg
attctgttcgacgacgggcatgactccggcctcgccgggcagatcacgtgccgcgccgac
acgccgaacacgtactacacgcagcgcctcggactcggtttcgacgagatcgccgaatcg
aacctgctgcaggtcaatcaggatctcgaagtgatcgtcggccagggcattccgaacccg
gcgaaccgcttccacacatggatctatcgcgcgcgtccggacgtcaactgcatcatccac
acgcatccggcgcacgtcgccgcgctatcgatgctcgagacgccgctcgtcgtgtcgcac
atggacacctgtccgctctacgacgattgcgcgttcctgaaggactggccgggcgtgccc
gtcggcaacgaggaaggcgagatcatctcgaacgcgctcggcgccaagcgcgcgatcctg
ctgtcccatcacggccagctcgtcgtcggcaagacgatcgaagaggcctgcatgctcgcg
atcctgatcgagcgcgcggcgcggctgcaactgctcgcgatggccgcgggcgcgatcgag
ccgattccgcccgcgctcgcgaccgacgcgcgcgactggatctcgacgcccaagcgcgac
gcggtgacgttcgcgtactacgcgcgccgcgcgctgcgccatcaccccgactgcctcggc
tga

DBGET integrated database retrieval system