KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_3771Help
Entry
BTRA_3771         CDS       T03391                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00010  Glycolysis / Gluconeogenesis
bthm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTRA_3771
Enzymes [BR:bthm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BTRA_3771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase LPD22
Motif
Other DBs
NCBI-ProteinID: AIC89171
Position
2:367511..368125
Genome map
AA seq 204 aa AA seqDB search
MTPPIKLVLFDMEGVLSAYDRAARTARLADLTGRPPDAVRRAIWESGLEARADAGLIGVD
QYLSELAALLGAPVSRDDWLIARRASITPNLDVVALAERVARRSRIAVLTNNCRLVTDYI
DYLNPPVARVFGAHVYPSATFGAAKPDAQAYLGCVGWLGVTAQETLFIDDADANVEGAAS
AGLLACKFVSVQALAEELERRRLI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgccgatcaagctggtgctgttcgacatggagggcgtgctgtcggcgtacgac
cgcgccgcgcgcaccgcacgcctcgccgacctgacggggcggccgcccgacgcggtgcgc
cgtgcgatctgggagtcgggcctcgaagcgcgcgccgacgcggggctcatcggcgtcgac
caatacctgagcgagctggccgcgctgctcggcgcgccggtgagccgcgacgactggctg
atcgcgcgccgggcgtcgatcacgccgaacctggacgtcgtcgcgctggccgagcgcgtc
gcgcggcgcagccggatcgcggtgctgacgaacaactgccggctggtcaccgattacatc
gactatctgaatccgcctgtcgcgcgcgtgttcggcgcgcacgtatatccgtcggcgacg
ttcggcgcggcgaagccggatgcgcaggcgtatctcggatgcgtcggatggctcggcgtg
acggcgcaagagacgctgttcatcgacgacgccgatgcgaatgtcgagggcgcggcgagt
gccgggttgctggcgtgcaagttcgtaagcgtgcaggcgctggcggaggagctcgagcgg
cggcggttgatctag

DBGET integrated database retrieval system