KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_5469Help
Entry
BTRA_5469         CDS       T03391                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00430  Taurine and hypotaurine metabolism
bthm00620  Pyruvate metabolism
bthm00640  Propanoate metabolism
bthm00680  Methane metabolism
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
bthm01200  Carbon metabolism
Module
bthm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTRA_5469 (ackA)
   00640 Propanoate metabolism
    BTRA_5469 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BTRA_5469 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BTRA_5469 (ackA)
Enzymes [BR:bthm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BTRA_5469 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase UBA_2
Motif
Other DBs
NCBI-ProteinID: AIC90022
Position
2:complement(2528719..2529897)
Genome map
AA seq 392 aa AA seqDB search
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRTPLQLEYSNSGDAHTVPLAA
SVTDDLHDVLDEALNWIGAHLPVHELVSVGHRVVHGGDAFGGPVRIDERTLDAIAALVPL
APLHQPQSVRLIRALRHLRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDEGVKRYGFH
GLSYRYVAGRLRERHPAVARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGVPMATR
CGTLDAGVVLHLQKTLGYSVDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALAL
FAFRIAGEAARLATTLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDADANARNAE
IVSSDASRVAVLVVPTDEEQVIARDAASVLHA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgctgctgctcacgttcaatgccggctcgtcgacgctgaagatcggcctc
tacagcgtcgcgaacggcgagcccgcgccgctcgggcgcggcaagatcgacttcaaccgc
acgccgctgcagctcgaatactcgaacagcggcgacgcgcacacggtgccgctcgccgcg
agcgtcaccgacgatctgcacgacgtgctcgacgaggcgctcaactggatcggcgcgcat
ctgccggtgcacgagctggtgtcggtggggcaccgcgtcgtgcacggcggcgacgcgttc
ggcgggccggtgcgcatcgacgagcgcacgctcgacgcgatcgcggcgctcgtgccgctc
gcgccgctgcatcagccgcagagcgttcggctgattcgcgcgctgcgccacctgcggccg
catctgccgcaggtggcgtcgttcgacaccgcattccaccgcacgcagtccgatctcgtg
cggcgcttcgcgctgccgcgcgcgctgttcgacgaaggcgtcaaacgctacggctttcat
gggctgtcgtaccggtacgtcgccgggcggctgcgcgagcggcatccggcggtggcgcgc
ggcaaggtcgtcgccgcgcatctcggcagcggcgcgagcctctgcgcgctcgacgcgggc
gtgagccgcgacaccagcatgggcttctcgacgctcgacggcgttccgatggcgacgcgc
tgcggcacgctcgacgcgggcgtcgtgctgcacctgcagaagacgctcggctactcggtc
gacgacgtcgagcagatgctgtatcaccgctcgggcttgctcggcgtgtccggcgtgagc
ggcgacgcgcgcgcgctgctcgccgatccgtcggccggcgcgcgcgatgcgctcgcgctg
ttcgcgttccggatcgcgggcgaggcggcgcggctcgcgacgacgctcggcgggctcgac
gcgctcgtgttcaccgcgggcatcggcgagcatcagccgcaaacgcgcgccgcggtgtgc
gagcggctgcgctggctcggcgtcgaactcgacgcggacgcgaacgcgcgcaatgcggag
atcgtgagcagcgacgcaagccgcgtcgcggtgctcgtcgtgccgaccgacgaagagcag
gtgatcgcgcgggatgcggcgtcggttctgcatgcgtga

DBGET integrated database retrieval system