KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_551Help
Entry
BTRA_551          CDS       T03391                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00360  Phenylalanine metabolism
bthm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bthm00790  Folate biosynthesis
bthm01100  Metabolic pathways
bthm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTRA_551 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTRA_551 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTRA_551 (phhA)
Enzymes [BR:bthm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BTRA_551 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIC88684
Position
1:complement(618831..619724)
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLKEQFDAGLETRADFTIDQPLARYGDLDHAVWRQLYARQASLLRGRACDAFI
GGLARIGLAPDRVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALGVADDPRALALLARLYWYTV
EFGLIRGARGENGLRIYGAGIVSSKGETLYSLESASPNRIGFDLERVMRTRYRIDTLQKT
YFVIDDFAQLFALADIDARTLAARLANAPEHAAGAVLDGDHVLTRGTGEGWATDADA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgtcaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgc
gccgatttcaccatcgatcagccgctcgcccgttacggcgacctcgaccacgcggtgtgg
aggcaactgtacgcgcggcaggcatcgctgctgcgcggccgcgcgtgcgacgcgttcatc
ggcggcctcgcgcgcatcggtctcgcgcccgatcgcgtgccgtcgttcgccgacgtgaac
cgccggctcgagcccgcaaccggctggcgcatcgtcgcggtgccgggcctcgtgccggac
gccgtcttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgtcgc
ccggatcagctcgattatctgcaggagccggactgcttccacgatctgttcggccacgtg
ccgctgctgatcgatcccgtattcgccgactacatgcacgcgtacggccgcgcggcgctc
ggcgtcgccgacgatccgcgcgcgctcgcgcttctcgcacgcctctattggtatacggtc
gaattcggcctgatccgcggcgcgcgcggtgaaaacgggctgcggatctacggcgcgggc
atcgtgtcgagcaagggcgagacgctctacagccttgaaagcgcgtcgccgaaccggatc
ggcttcgatctcgagcgcgtgatgcggacccgttaccggatcgacacgctccagaagacc
tacttcgtgatcgacgatttcgcgcaactcttcgcgctcgccgacatcgacgcgcgcacg
cttgccgcgcggctcgccaacgcgcccgagcacgcggcgggcgccgtgcttgacggcgat
catgtgctcacgcgcggcacgggtgaaggttgggcaaccgatgcagacgcctga

DBGET integrated database retrieval system