KEGG   Burkholderia thailandensis USAMRU Malaysia #20: BTRA_5626Help
Entry
BTRA_5626         CDS       T03391                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bthm  Burkholderia thailandensis USAMRU Malaysia #20
Pathway
bthm00360  Phenylalanine metabolism
bthm00362  Benzoate degradation
bthm00621  Dioxin degradation
bthm00622  Xylene degradation
bthm01100  Metabolic pathways
bthm01120  Microbial metabolism in diverse environments
bthm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bthm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTRA_5626 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTRA_5626 (dmpG)
   00622 Xylene degradation
    BTRA_5626 (dmpG)
   00621 Dioxin degradation
    BTRA_5626 (dmpG)
Enzymes [BR:bthm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BTRA_5626 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm ThiG
Motif
Other DBs
NCBI-ProteinID: AIC89870
Position
2:2698957..2700000
Genome map
AA seq 347 aa AA seqDB search
MILISDATLRDGNHAIRHQLSAAQIHAYARAADEAGIDIVEVGHGNGLGGSSCLLGQTPI
GDRLMLETARAALRTSRLGVHFIPGLGKAADIALALEIGVDVVRVATHCTEANVSARFIE
QTRVAGRTAFGVLMMSHMAPSDVLLAQAKLMERYGAQAVVLMDSAGYSTPSLVRAKVERL
VDGLDIDVGFHAHNNLGLAVANSLVALEAGARIVDACVKGFGAGAGNTQLETLVAAMERE
GHDTRTTFEHVMALARGTEAFLNPKTPHIQPANIASGLYGLFSGYVPHIQKAAQEFGVNE
FELYKRLAERKLVAGQEDIIIEEASRLARERDVQRATDGVRISELSA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatactgatcagcgatgcgaccttgcgcgacggcaaccacgcgattcgtcaccagttg
agcgccgcgcagatacatgcgtatgcacgcgcggcggacgaagccggcatcgacatcgtc
gaagtcggtcacggcaacggtctcggcggctcgtcgtgcctgctcgggcagacgccgatc
ggcgatcgcctgatgctcgagaccgcgcgcgccgcgctgcgcacgagccggctgggcgtg
catttcatccccgggctcggcaaggcggcggacattgcgctcgcgctcgagatcggcgtc
gacgtcgtgcgcgtcgcgacgcattgcacggaagcgaacgtgtccgcgcgattcatcgag
cagacccgggtggccggccgcacggcgttcggcgtgctgatgatgtcgcacatggcgccg
tccgacgtgctgctcgcgcaggcgaagttgatggagcggtacggcgcgcaggcggtggtg
ctgatggacagcgccggctattcgacgccgtcgctcgtgcgcgcgaaggtcgagcgcctc
gtcgacggcctcgatatcgacgtcggctttcatgcgcacaacaacctcggcctcgcggtt
gcgaacagtctcgtcgcgctcgaagcgggggcgcgcatcgtcgatgcgtgcgtgaagggc
ttcggcgccggcgcgggcaatacgcagctcgaaacgctcgtcgccgcgatggagcgcgaa
gggcatgacacacgcacgacgttcgagcatgtgatggcgctcgcgcgcggcaccgaggcg
tttctcaatccgaagacgccgcatatccagccggcgaacatcgcgagcgggctgtacgga
ctcttctccggctacgtgccgcatatccagaaagccgcgcaggaattcggcgtgaacgag
ttcgagctgtacaagcggctcgcggagcgcaagctcgtggccggacaagaggacatcatc
atcgaagaggcgagccgtctcgcacgcgaacgggacgtgcagcgcgcgacggacggcgtg
cggatcagcgagctgtccgcgtga

DBGET integrated database retrieval system