KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_02077Help
Entry
Btheta7330_02077  CDS       T04540                                 

Definition
(GenBank) Phenylacetate-coenzyme A ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00360  Phenylalanine metabolism
btho01100  Metabolic pathways
btho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Btheta7330_02077
Enzymes [BR:btho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     Btheta7330_02077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding LuxE FXa_inhibition
Motif
Other DBs
NCBI-ProteinID: ALJ41634
UniProt: A0A0P0F4F7
Position
2580769..2582067
Genome map
AA seq 432 aa AA seqDB search
MIWNETIECMDRESLRKIQSIRLKKIVDYVYHNTPFYRKKMQEMGITPDDINTIDDIVKL
PFTTKHDLRDNYPFGLCAVPMSQIVRIHASSGTTGKPTVVGYTRKDLSSWAECISRAFTA
YGAGRSDIFQVSYGYGLFTGGLGAHAGAENIGASVIPMSSGNTEKQITLMHDFGSTVLCC
TPSYALYLADAIKDSGYPREEFQLKVGALGAEPWTENMRHEIEEKLGIKAYDIYGLSEIA
GPGVGYECECQHGTHLNEDHYFPEIIDPNTLQPVEPGQTGELVFTHLTKEGMPLLRYRTR
DLTALHYDKCSCGRTLVRMDRILGRSDDMLIIRGVNVFPTQIESVILEMEEFEPHYLLIV
GRENNTDTMELQVEVRPDFYSDEINRMLALKKKLASRLQSVLGLGVNVKLVEPRSIERSV
GKAKRVIDNRKI
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatttggaatgagaccattgagtgtatggaccgcgaaagtcttcgcaagattcaaagc
atacgactcaagaaaattgtggattacgtttatcacaacacgcctttttaccggaagaaa
atgcaggaaatgggtatcacccccgatgatatcaatacgattgatgatatcgtgaaactg
ccgtttaccacgaaacatgatttaagagataattatcctttcggactttgtgccgtgccg
atgagccagatcgtgcgtattcatgcctcttccggaacgaccggaaagccgacggtagtg
ggatatacccgcaaagacctttcttcgtgggcagaatgtatatcgcgtgcttttactgct
tatggagcaggacgctcagatatatttcaggtttcctatggttacggactttttacgggt
ggcctgggagcacacgccggagctgagaatattggtgcttctgtgattccgatgtccagt
ggtaatacagaaaagcagattacattgatgcatgattttggatcaacggttctttgctgt
actccttcgtatgcactttatctggcggatgccattaaagattccggctatccgcgggag
gaattccaactgaaagtgggagccttgggtgcggagccctggacggagaatatgcgtcat
gaaatcgaagaaaaactcggtattaaagcatatgatatctacggactgagtgaaattgcc
ggaccgggtgtaggttacgaatgtgaatgtcagcatggtacgcacttgaatgaggatcat
tatttcccggaaattattgatccgaatacattgcagccggtagaacccggacagacgggc
gagctggtatttacgcacctgacgaaggaaggaatgccattgcttcgttatcgtacgcgt
gacttgacggccttgcattatgataaatgctcctgcgggcgtacattggttcgtatggac
cgtatcctgggacgtagtgacgatatgctgattatccgtggtgtcaatgtattcccgact
cagatcgagtccgtcattcttgagatggaagaattcgaaccacattatttgttgatagtg
gggcgtgaaaacaataccgatacgatggaacttcaggtagaagtgcgcccggatttctat
tcggatgagattaaccgtatgctagcgttgaagaagaaactggcaagccgtctccaaagc
gtacttggactgggagtcaatgtgaaactggtagaaccgcgtagcattgaacgcagcgtg
ggcaaagctaaacgagtgattgataacagaaaaatttaa

DBGET integrated database retrieval system