KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_08365Help
Entry
YBT1520_08365     CDS       T03435                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    YBT1520_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Cnd3
Motif
Other DBs
NCBI-ProteinID: AHZ50407
Position
complement(1603051..1604049)
Genome map
AA seq 332 aa AA seqDB search
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIIMAAIMNFLGAMTF
TGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAI
AAAGISSLNLKGFIKIIEALIISPIIAFVIGYTVYSIFKVVFKNFNLTKTNKNFRIFQIF
TAALQAYTHGTNDAQKAMGIITMALMANNYHTSSDIPFWVQLSCAIAMGLGTSVGGWKII
KTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKW
GTAKRMLITWVITLPISASLAALFYYLLHFVF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacactcttgatactgaccgttttagtagtcatttgcgctttagcttttgacttt
atcaatggatttcacgatacagcaaacgctattgcaacggctgtttcaacgaaagctcta
aagcctagacatgccattattatggcggctattatgaactttttgggcgcaatgacattt
acaggtgtagcaaaaacgattacaaaagatatcgttgatccattcgccttacaaaatggt
tctcttgtaattttagctgctttgcttgcggcaatagcttggaacttaattacttggtac
tacggtattccaagtagttcttcgcatgcaattatcggctcaatcgcaggtgcagcaatt
gcggccgctgggattagctcgctaaatcttaaaggatttattaaaattattgaagcttta
atcatttcaccgattatcgctttcgttattggttataccgtatacagtatttttaaagta
gtatttaaaaactttaacttaacaaaaacgaataagaacttccgtatattccagattttc
actgcagcattacaagcctacacacacggtacgaatgatgcacaaaaagcaatgggaatc
attacgatggctcttatggctaataactatcatacttctagcgatatcccgttctgggta
caattatcttgtgctatcgcaatggggcttggtacttctgtcggcggatggaaaattatt
aaaactgtcggtggacaaattatgaaaattcgtcctgtaaatggtgtagctgccgattta
tcatcatcacttgttattttcggtgcaacattcattcacttaccggttagtacgacgcac
gttatctcttcttctattttaggggttggtgcttctcaccgtgtgaaaggggtaaaatgg
ggaactgcaaaacgcatgttaattacatgggttattacacttcctatttcagcttcttta
gctgctctgttttactacctattacattttgttttctaa

DBGET integrated database retrieval system