KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_21355Help
Entry
YBT1520_21355     CDS       T03435                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Pathway
bthr00071  Fatty acid degradation
bthr00072  Synthesis and degradation of ketone bodies
bthr00280  Valine, leucine and isoleucine degradation
bthr00310  Lysine degradation
bthr00362  Benzoate degradation
bthr00380  Tryptophan metabolism
bthr00620  Pyruvate metabolism
bthr00630  Glyoxylate and dicarboxylate metabolism
bthr00640  Propanoate metabolism
bthr00650  Butanoate metabolism
bthr00900  Terpenoid backbone biosynthesis
bthr01100  Metabolic pathways
bthr01110  Biosynthesis of secondary metabolites
bthr01120  Microbial metabolism in diverse environments
bthr01130  Biosynthesis of antibiotics
bthr01200  Carbon metabolism
bthr01212  Fatty acid metabolism
bthr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YBT1520_21355
   00630 Glyoxylate and dicarboxylate metabolism
    YBT1520_21355
   00640 Propanoate metabolism
    YBT1520_21355
   00650 Butanoate metabolism
    YBT1520_21355
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YBT1520_21355
   00072 Synthesis and degradation of ketone bodies
    YBT1520_21355
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YBT1520_21355
   00310 Lysine degradation
    YBT1520_21355
   00380 Tryptophan metabolism
    YBT1520_21355
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YBT1520_21355
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YBT1520_21355
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YBT1520_21355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthr04147]
    YBT1520_21355
Enzymes [BR:bthr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YBT1520_21355
Exosome [BR:bthr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBT1520_21355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHZ52866
Position
complement(4127775..4128950)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGHFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacagcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggagtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggacactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgagcatccacgtgca
gatattacagcggaaaaattagcaggattaaaaccagcattccgtaaagatgggtctgta
actgcaggtaatgcatctggcctgaatgacggaagtgcagttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagacccgaaaattatgggtattggaccagcaccagcaattcgtaaaggtttagaa
aaagtagattggtcattggaagatgcagatttacttgaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggcttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system