KEGG   Bacillus thuringiensis serovar kurstaki YBT-1520: YBT1520_29784Help
Entry
YBT1520_29784     CDS       T03435                                 

Definition
(GenBank) hypothetical protein
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
bthr  Bacillus thuringiensis serovar kurstaki YBT-1520
Pathway
bthr00998  Biosynthesis of secondary metabolites - other antibiotics
bthr00999  Biosynthesis of secondary metabolites - unclassified
bthr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    YBT1520_29784
   00999 Biosynthesis of secondary metabolites - unclassified
    YBT1520_29784
Enzymes [BR:bthr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     YBT1520_29784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall 2-Hacid_dh_C Shikimate_DH GFO_IDH_MocA Polysacc_deac_3
Motif
Other DBs
NCBI-ProteinID: AHZ54466
Position
pBMB422:81558..82523
Genome map
AA seq 321 aa AA seqDB search
MYLNTKHINEMGVNWEETINVISKAVKSLDLDDFSQPIKPYLRFDDPANRIIAMPAYIGG
EFKVSGIKWIASFPKNIEKGIQRAHSVTILNDAMTGKPFATLNTAMVSVIRTASVTGLMI
REFAKLRDLNNVKVGIIGFGPIGQMHLKMVTALLGDKIESVYLYDINGIKDELIPEDIYS
KTQKVNAYEEAYNDADIFITCTVSAEGYIDKKPKDGALLLNVSLRDFKPDILEYTKSLVV
DNWEEVCREKTDVERMHLERGLQKEDTVSIADVVIRGALQNFPYDKAILFNPMGMAIFDV
AIAAYYYQRAREKEIGVLLED
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaaataccaaacatatcaatgaaatgggtgttaattgggaagaaacaataaat
gtcatttcaaaggcagtaaaaagtcttgatttagatgatttttctcagccaattaagcca
tacttacgtttcgatgatccggctaatagaattattgctatgccagcttatattggagga
gaatttaaggtttcaggaatcaaatggatagctagttttccgaagaatattgagaaaggt
attcagcgtgctcattcagttactatattaaatgatgctatgactggaaaaccatttgcg
acgcttaatacagcaatggtcagtgtaatacgaacagcttctgtaacagggttaatgatt
cgagagtttgccaagttaagagatttaaataatgttaaagttggaattattggatttgga
cctattggtcagatgcatttaaagatggtaactgccctattaggcgataaaatcgaaagt
gtttacctatatgatatcaatggaattaaagacgaattaattcctgaggatatttattct
aaaactcaaaaggttaatgcttatgaagaagcctataatgatgctgatatttttattact
tgtactgtttctgcagaaggttatattgataagaaacctaaagatggagcgctactactc
aatgtttctcttcgtgattttaagcctgatatcttagaatatacaaaatccctagttgtt
gataattgggaagaagtctgtcgtgaaaaaactgatgttgaaaggatgcaccttgaaaga
ggtttacaaaaagaagatacagtatcaattgctgacgttgtaatccgaggagcactgcaa
aacttcccttatgacaaagcaatattatttaatccaatgggtatggccatttttgatgta
gccattgctgcttattactatcaaagggctagggaaaaggaaataggtgttttattagaa
gactag

DBGET integrated database retrieval system