KEGG   Brochothrix thermosphacta: CNY62_03980Help
Entry
CNY62_03980       CDS       T05089                                 

Definition
(GenBank) bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bths  Brochothrix thermosphacta
Pathway
bths00270  Cysteine and methionine metabolism
bths00670  One carbon pool by folate
bths01100  Metabolic pathways
bths01110  Biosynthesis of secondary metabolites
bths01120  Microbial metabolism in diverse environments
bths01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bths00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CNY62_03980
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CNY62_03980
Enzymes [BR:bths01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CNY62_03980
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     CNY62_03980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR PsaL DUF1563 DUF737
Motif
Other DBs
NCBI-ProteinID: ATF25615
UniProt: A0A1D2L884
Position
813682..815547
Genome map
AA seq 621 aa AA seqDB search
MTNLRDSLKNNVLIADGAIGTLLKQHDHTHGHGPSIDALNLSQPDQIRDYHLAYLRAGAD
VIQTNTYGANTLKLARYGLEKDIVAINQAGVRLAKEAIKIHGRGFLLGNIGGINAEYVPV
HLRSTSLDDIQKVFREQLYLLLLEGVDGLLLETYYDLEELKTVLKIAREVTDIPIIANVS
IHEVGILQNGTRLDIALQELADLGADVVGVNCQLGPYHMIKALEGVPILTNASLAVYPNA
SLPTVEDGEIIYQTEPSYFKKYAERFRLQGAHLIGGCCGTTPAHIANLRKGLESTTPVDT
KVVIPLPDEVVFTKPKKFRGKRLVDKVLTETTVLVELDPPRTLNTETFFKGVQALYNQGT
DAVTISDNSLASPRISNLALAALIKERYNHSPLIHITTRDHNLVGLHAHVMGLHKLGIHD
LLAITGDPTKVGDFPGASSVFDLRSVELVQLIKRYNDGLSYSGKSLGEKANFNVAAAFNP
NIKKLQQAYKIIQRKIDYGADYFITQPVYDVETVHQLADMLNEHNITTPFFIGVMPLLSS
RNAEFLHNEVPGIRLSDEVRDRMKQADLDNRSLEVGLEISKEIIDAILERFNGIYIITPF
QRYEVSLELLHYAKKTAPILK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttacgcgattcactaaaaaataatgttttaattgctgatggtgcaatcggt
actttattaaaacaacatgatcacacacatggtcatggcccctctattgatgctctcaac
ttatcacagcctgaccaaattcgtgactatcatttagcatacttgcgagctggagctgat
gttattcaaacaaatacctatggcgcaaatactttaaagttagctcgttatggtctggaa
aaagacattgtagcaattaatcaagcaggcgttcgcctcgctaaagaagccattaaaata
cacgggcgtggtttcttacttggaaatatcgggggcattaatgccgaatatgtacctgtc
cacttacgttcaacatcactcgatgatattcaaaaagttttcagggaacaactttatctt
ttattacttgaaggtgtagatgggttattacttgaaacatactatgatcttgaagagtta
aaaacggtattaaaaatcgcacgtgaagtgactgatattcccatcatcgctaatgtatct
attcatgaggtcgggattttacagaatgggactcgtcttgatattgccctacaagaattg
gctgatttaggagctgacgttgttggtgttaactgtcaattaggtccttatcatatgatt
aaagctttagaaggtgttcctatactcactaatgcctcactcgcagtttatccgaatgct
agtttacccactgtcgaagatggtgaaatcatttaccaaactgagccgagctatttcaaa
aaatatgccgaacgctttcgcttacaaggtgcccatttaattggtggctgttgtggcact
acaccggctcacattgctaacctgcgtaaaggccttgaatctacaacaccagttgataca
aaagtagttattccattgcctgatgaagtcgtttttaccaaaccaaaaaaattcagagga
aaacgtttggttgataaagtcctgacagaaacaactgttttagtcgaacttgatcctccg
cgtacccttaatactgagactttttttaaaggcgtacaagctctttataatcaaggaact
gatgctgttactatttcggataattcgttagcttccccacgtattagcaatttagcattg
gcggctttaattaaagaacgatacaaccacagtcctttaatacacattactacccgtgat
cataacttagttggattacatgctcacgttatggggctgcataaacttggcatccatgat
ttattagcaattacaggtgaccctacaaaagttggggatttccccggtgcttcgtctgtc
tttgatttacgtagtgttgaattggtacaacttatcaagcgctataatgatggtttatcc
tattctggtaaatcgttgggtgaaaaagccaattttaatgtcgcggctgcgtttaatcct
aatataaaaaaattacaacaagcttataaaatcatccaacgtaaaattgattatggcgca
gattatttcattactcaacctgtttatgatgttgaaacagtccatcaattagccgatatg
ctaaatgaacacaacattacaacaccctttttcattggcgttatgccacttctatctagt
cgtaatgcagaatttcttcataacgaagtcccaggtattcgcttgtcggatgaggtcaga
gaccgtatgaaacaagctgatcttgataatcgtagtttagaagttggtttggaaatttca
aaagaaattattgatgctattttagaaagatttaatggcatttatattatcacacccttt
caacgctatgaagtaagtctagagttgttacattatgcaaaaaaaacggcacccatctta
aaataa

DBGET integrated database retrieval system