KEGG   Brochothrix thermosphacta: CNY62_08355Help
Entry
CNY62_08355       CDS       T05089                                 

Definition
(GenBank) TIGR01457 family HAD-type hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bths  Brochothrix thermosphacta
Pathway
bths00627  Aminobenzoate degradation
bths01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bths00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CNY62_08355
Enzymes [BR:bths01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     CNY62_08355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Acid_phosphat_B DUF218
Motif
Other DBs
NCBI-ProteinID: ATF26388
UniProt: A0A1D2K067
Position
1731528..1732292
Genome map
AA seq 254 aa AA seqDB search
MTEYKAYLFDLDGTIYHGGKPIPEAVTMVNHLADKGIPYVFVTNNSTTSPQQVAERLQKM
GIPAEAKDVVTSSQATVHYLNEQGCGKAMYTIGQAGLFKELEAAGYQQTEEQPDVVIIGM
NPEVTYKELAHATLAIAKGALFISTNPDKALPMEIGLMPGNGALTAFVATATSQEPTFIG
KPFPTLMHLALDRLKLTKDEVLMVGDNYLTDISAGINSDIDTLLVLSGFTQRADLETVEK
QPTYIVNSLSDWKV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacagagtataaggcatatttatttgatttagacggcacaatttatcatggaggcaaa
ccaataccagaagctgtaacaatggttaatcatttagcagataaaggtattccttatgtt
tttgtgacaaacaactcaacaacatcaccacaacaagtggcagaacgtttgcaaaaaatg
ggcattccagcagaagcaaaagatgtggtgacatcatcacaagcaaccgttcattattta
aatgaacaaggttgtggaaaagcgatgtacacgattggacaagctggtttgttcaaggaa
ttagaagcggcaggctatcaacaaactgaggaacaaccggatgttgtcattattggaatg
aatccagaagttacttataaagaattggcacatgcaacattagcgattgctaaaggtgcg
ttatttatctcaactaatcctgacaaggcgctgccgatggaaataggtttaatgccagga
aacggtgctctaactgcttttgtagcaacagcaacgagtcaggaacctacatttataggt
aaaccatttccaacattgatgcatctagcgttagaccgattaaaactgacaaaagacgaa
gttttaatggttggtgacaattatttaacggatatttcagcgggcatcaacagtgacatc
gatactctcttagttttatcaggcttcacacaacgagctgatttagaaacggttgagaaa
caaccgacttatattgtgaattcactctcagattggaaggtttaa

DBGET integrated database retrieval system