KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch0287Help
Entry
H175_ch0287       CDS       T02474                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00250  Alanine, aspartate and glutamate metabolism
btht00330  Arginine and proline metabolism
btht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H175_ch0287
   00330 Arginine and proline metabolism
    H175_ch0287
Enzymes [BR:btht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     H175_ch0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SPW
Motif
Other DBs
NCBI-ProteinID: AGF99000
UniProt: M1Q9H3
Position
330906..332453
Genome map
AA seq 515 aa AA seqDB search
MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEKITTEDKIVSVNPANK
EELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRAAAIVRRRKHEFSAILV
KEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIEYNRFSYIPLGVGVIISP
WNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGSE
VGDYLVDHPRTRFVSFTGSRDVGIRIYERAAKVNPGQIWLKRVIAEMGGKDTIVVDKEAD
LELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRAVELTKELTVANPAVLGTNMG
PVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQPTIVADVAEDARLMKEEIFGP
VVAFCKAKDFDHALAIANNTEYGLTGAVITNNRDHIEKAREDFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagcatacaaacatgagccatttacagatttttcagtggaggctaacaaatta
gcgtttgaagaaggtttaaagaaagtagaatcttatcttggacaagactatccattaatt
attgggggagaaaaaatcactacagaagacaaaattgtttctgtaaaccctgcaaataaa
gaggaacttgttggtcgtgtttcaaaagcaagccgtgagttagctgaaaaagcaatgcaa
gtagcggatgaaacattccaaacttggagaaaatcaaagccagaaatgcgtgcagacatt
ttattccgtgctgcagcaatcgttcgtcgcagaaaacatgaattctctgctattcttgta
aaagaagcaggtaagccatggaatgaggcagatgctgatacagcagaagcaatcgacttt
atggaatattatggtcgtcaaatgttaaaattaaaagacggtattccagtagaaagccgt
ccaattgaatataatcgtttctcttacattccattaggagtaggtgttatcatttctcct
tggaacttcccattcgcaattatggcaggtatgacaacagctgctttagtttctggtaac
acagtattactaaaaccagctagtacaactcctgtagtagcagcgaaatttatggaagta
ttagaagaagctggcttaccagctggcgtagtaaacttcgttccaggtaatggttctgaa
gttggtgactacttagtagatcatcctcgtacacgtttcgtaagcttcacgggatctcgt
gatgtaggtatccgtatctatgagcgtgcagcgaaagtaaacccaggccaaatttggtta
aaacgcgttatcgctgaaatgggcggtaaagatacaatcgttgttgataaagaagcagat
cttgaattagcagctaagtctatcgttgcatcagcattcggattctcaggacaaaaatgt
tctgcatgttctcgtgcagtaatccacgaagatgtatacgatcacgtattaaatcgtgct
gttgaattaacaaaagaattaacagttgctaacccagcagtattaggtacaaacatgggt
cctgttaatgaccaagctgcattcgataaagtaatgagctatgttgcaattggtaaagaa
gaaggtagaatcttagcaggtggcgaaggagacgattctaaaggctggttcatccaacca
acaatcgttgctgatgttgcagaagatgctcgcttaatgaaagaagaaatcttcggacca
gtagtagcattctgtaaagcaaaagacttcgatcatgcacttgcaattgcaaacaatacg
gaatacggtttaacaggtgctgttattactaacaaccgtgaccatattgaaaaagcacgt
gaagacttccacgttggtaacttatacttcaaccgtggatgtactggtgcaatcgtaggt
taccaaccattcggtggctttaacatgtctggtacagactctaaagctggtggacctgat
tacttagcacttcacatgcaagcaaaaactacttctgaaactttataa

DBGET integrated database retrieval system