KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch0603Help
Entry
H175_ch0603       CDS       T02474                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:btht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    H175_ch0603
Enzymes [BR:btht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     H175_ch0603
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     H175_ch0603
    1.1.1.-  
     H175_ch0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AGF99316
UniProt: M1Q3X4
Position
686483..687535
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGTVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVIEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVIGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactactttggcataatcaacgtgatgtacgagtagaagaagtaccagaacca
acagtaaaaccaggaacagtgaaaatcaaagttaaatggtgtggtatttgtgggacagac
ttgcatgaatatttagcagggcctatttttattccaacagaagaacatccattaacacat
gtgaaagcacctgttattttaggtcatgagtttagtggtgaggtaatagagattggtgaa
ggagttacatctcataaagtgggagaccgcgttgttgtagagccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcat
cacattccagatgaaatgacgtatgaacaaggtgcgcttgtagaaccagcagcagtagca
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagctgtatttggttgc
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagttgaactttctaaagaacgtcaagagttagcgaaattagcaggtgcggattatgta
ttaaatccagcaactcaagatgtgttagctgaaattcgtaacttaacaaatggtttaggt
gtaaatgttagctttgaagtaacaggtgttgaagttgtactacgccaagcgattgaaagt
acaagcttcgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccaaataacttagtattaaaagaaaaagaagttattggtattttaggataccgtcacatc
ttcccagctgttattaaattgattagctctggtcaaattcaagcagagaaattaattacg
aaaaaaattacagtggatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system