KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch1749Help
Entry
H175_ch1749       CDS       T02474                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00020  Citrate cycle (TCA cycle)
btht00620  Pyruvate metabolism
btht00650  Butanoate metabolism
btht01100  Metabolic pathways
btht01110  Biosynthesis of secondary metabolites
btht01120  Microbial metabolism in diverse environments
btht01130  Biosynthesis of antibiotics
btht01200  Carbon metabolism
Module
btht_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btht_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H175_ch1749
   00620 Pyruvate metabolism
    H175_ch1749
   00650 Butanoate metabolism
    H175_ch1749
Enzymes [BR:btht01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     H175_ch1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGG00462
UniProt: M1Q782
Position
1774232..1775746
Genome map
AA seq 504 aa AA seqDB search
MENNLDRIRDQRLKDRVVTPEEAASWIQSGMTLGLSGFTRAGDVKAVPFALVNRVKNDES
FKVNVYTGASLGSDVDKLFAEAGILGKRLPFQADATMRKGINNGDFLFVDQHLSHTAELL
RADVLDIDFAILEAVAITEDGMIIPTTSIGNSLAFSLNAKSIIIEMNMAQSAQLEGLHDL
YEPGKQGERLPIPLVKTDDRIGTIGIPIDPEKVKGIVFTNQLDSPSTIVPPDEETVIMAQ
HLIEFLREEVKVGRLTNRLAPLQSGIGSVANAVLHGMLDSEFEDLEVYSEVLQDAVFDLM
DAGKVNFASCCSITLSEEKMQQVFSNFEKYRDKLMMRPQEISNHPEIIRRLGLISINTAL
ELDIYGNVNSTHVLGTKMMNGIGGSGDFARNARLAIFVTKSIAKGGNISSIVPFISHVDH
TEHDVDVIVTEQGYADLRGLAPRERVELIIENCAHPMYREQLRAYYEEAKIRGGQTPHIL
EKAFSWHTNYAKNGTMLEAVVETV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaatttagatagaatcagagatcaacgcctaaaagatcgggtagttacacct
gaagaagcagcttcctggattcaaagtggaatgactttaggcttaagtgggtttacacgt
gcaggtgatgtaaaagcagtcccatttgcgcttgtaaaccgagttaagaatgatgaatct
tttaaagtaaatgtttatactggggcttctttaggatcggatgtagacaaattatttgct
gaggcaggaattttagggaaaagattacctttccaagctgacgcgactatgcgaaaagga
attaataacggagactttttatttgtggatcaacacttgtctcatacagcagagttactc
cgtgctgacgttctggatatagatttcgctattttggaagcggttgcgattacagaggac
ggaatgattattccaaccacttcaattggaaattccttagcgttttccttaaatgctaag
tctattattattgaaatgaatatggctcaatccgcgcaattagaggggctacatgatcta
tatgaaccaggtaaacaaggggagaggcttccaattccgcttgtgaaaacagatgaccga
attggaacaatcggtattccaattgatcctgaaaaagtaaagggaattgtgtttacgaat
caattggattcgccatcgacaattgttcctccggatgaagaaactgttattatggcacag
catttaatagaattccttcgagaagaagtcaaagtaggccgattaacaaatcgtttagcg
ccgttacaatcaggaattggttcagtggctaacgccgtattgcatggaatgttagattca
gaatttgaagatttagaagtatattccgaggttttacaagatgcagtttttgatcttatg
gatgctggaaaagtcaattttgcttcttgttgttctatcacgctttctgaagagaaaatg
caacaagtattttctaactttgaaaaatatcgtgacaaattaatgatgcgtccacaagag
atttccaatcatcctgaaattattcgtcgccttggattaatctcaattaatactgcatta
gaattagatatatacggaaatgttaactctactcacgttttaggtacaaaaatgatgaat
ggtattggtgggtctggcgattttgcaagaaatgcccgcctagctatctttgttactaaa
tcgattgcgaaaggtggtaacatttcaagtatcgttcctttcatttctcatgtagaccat
actgaacatgatgtagatgttatcgtcactgaacagggatatgccgacttaaggggactt
gcgccaagagaaagagtggaacttattattgagaattgcgcacatccaatgtatcgtgaa
cagctacgagcttattacgaagaagcaaaaataagaggtggacaaactcctcatatttta
gaaaaagctttttcttggcatacgaactatgctaaaaatggaacaatgcttgaagcggta
gtagaaactgtatag

DBGET integrated database retrieval system