KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch2041Help
Entry
H175_ch2041       CDS       T02474                                 

Definition
(GenBank) amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00330  Arginine and proline metabolism
btht00360  Phenylalanine metabolism
btht00380  Tryptophan metabolism
btht00627  Aminobenzoate degradation
btht00643  Styrene degradation
btht01100  Metabolic pathways
btht01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    H175_ch2041
   00360 Phenylalanine metabolism
    H175_ch2041
   00380 Tryptophan metabolism
    H175_ch2041
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H175_ch2041
   00643 Styrene degradation
    H175_ch2041
Enzymes [BR:btht01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     H175_ch2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGG00754
UniProt: M1QKC8
Position
2036321..2037796
Genome map
AA seq 491 aa AA seqDB search
MEIQFNPVLKKELTIHDIQTEMESGQLTSKELVMYYLHRIAKYDQDGPEINSILEINPDA
IFIAEALDYERKTKGIRGPLHGIPVLLKDNIETNDSMHTSAGTIALEQNISSEDAFLVTK
LREAGAVIIGKTNMTELANAMSFEMWAGYSARGGQTINPYGTGKDHMFVGGSSTGSAIAV
AANFTVVSIGTETDASILSPAVQNSVVGIKPTVGLISRRGIIPFTYSQDTAGPFARTVTD
AAILLGSLIGVDEKDVATHRSEGRAEQDYTKYLNVNGLNGAKIGVFNDAPKDYYENGEYD
EILFKETIQVLRNEGATVVENINIPSFHREWSWGVPLYELKHSLDNYLSKLPSTIPVHSI
SELMEFNKNIAERALKYGQTKLEGRKDFPNTLRNPEYLNARLEDIYFSQEQGIDFALEKY
NLDAILFPSYIASTICAKAGYPSIAIPAGYMESGRPFGITIASTAFSEGILIKLAYAFEQ
ATKHRKIPNLS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagattcagtttaatccagtattaaaaaaagaattaacaattcatgatatacaaacc
gaaatggaatctgggcagttaacttcaaaggaattagtgatgtattatcttcatagaatc
gcaaagtatgaccaagacggaccggaaattaattctattttagaaatcaatccagatgct
atttttatcgcagaagcgttagattatgaaagaaagacaaaaggtataaggggtccatta
catggtatacctgttttgcttaaagacaatattgaaacgaatgactccatgcatacaagt
gcaggtacgattgctctagaacaaaatataagcagtgaagatgcatttctcgttacaaaa
ttacgagaagccggagcagtaataataggaaaaacaaatatgacagaattagcaaatgca
atgtcttttgaaatgtgggctggatatagtgcaagaggtggtcaaacaatcaatccatac
ggaacgggcaaggaccatatgtttgttggcggatctagtacaggatctgcgatagcagtt
gctgctaactttacagtagtatctattgggacagaaaccgatgcttctattttgagccct
gctgttcaaaattctgtagtaggtattaaaccgactgtcggtttaattagtcgtagagga
attattccatttacttattcgcaagatacagctggaccatttgctagaacggtaacagat
gctgctattttgctagggagtttaattggagtagatgagaaagatgttgctactcataga
agtgaaggtagggcagagcaagattatacaaaatatcttaatgttaatggcttaaatgga
gcgaagattggtgtgtttaacgatgcaccaaaagattattacgaaaatggtgagtatgat
gaaatcttgtttaaggaaacgatccaagtattacgtaatgaaggagcgacagtagtagaa
aatattaatattccttcttttcatagagaatggagttggggagtgccgctttatgaactg
aagcatagtttagataactatctttctaaattaccttctactattccggtacattctatt
tcggagttaatggagtttaataaaaacatagcagaaagagctttaaaatatggacaaact
aagttagagggaagaaaagattttcctaatacgttacgaaatccagaatatttaaatgca
agattagaagatatatatttttcacaagaacaaggcattgattttgcattggaaaaatat
aatcttgatgcgatactgtttccttcctatatagcttctaccatatgtgcgaaagcgggt
tatccgtctatagcaatacctgcagggtatatggaaagcgggagaccttttggaattacg
attgcaagtactgcctttagtgaagggatattaattaagctagcttacgcttttgaacag
gcgacaaaacatagaaaaatcccaaacttgtcatga

DBGET integrated database retrieval system