KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch3556Help
Entry
H175_ch3556       CDS       T02474                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Pathway
btht00010  Glycolysis / Gluconeogenesis
btht00053  Ascorbate and aldarate metabolism
btht00071  Fatty acid degradation
btht00280  Valine, leucine and isoleucine degradation
btht00310  Lysine degradation
btht00330  Arginine and proline metabolism
btht00340  Histidine metabolism
btht00380  Tryptophan metabolism
btht00410  beta-Alanine metabolism
btht00561  Glycerolipid metabolism
btht00620  Pyruvate metabolism
btht00625  Chloroalkane and chloroalkene degradation
btht01100  Metabolic pathways
btht01110  Biosynthesis of secondary metabolites
btht01120  Microbial metabolism in diverse environments
btht01130  Biosynthesis of antibiotics
Module
btht_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:btht00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H175_ch3556
   00053 Ascorbate and aldarate metabolism
    H175_ch3556
   00620 Pyruvate metabolism
    H175_ch3556
  Lipid metabolism
   00071 Fatty acid degradation
    H175_ch3556
   00561 Glycerolipid metabolism
    H175_ch3556
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H175_ch3556
   00310 Lysine degradation
    H175_ch3556
   00330 Arginine and proline metabolism
    H175_ch3556
   00340 Histidine metabolism
    H175_ch3556
   00380 Tryptophan metabolism
    H175_ch3556
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H175_ch3556
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H175_ch3556
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H175_ch3556
Enzymes [BR:btht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     H175_ch3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGG02268
UniProt: M1PNC9
Position
3529637..3531121
Genome map
AA seq 494 aa AA seqDB search
MSQLAVNLHEKVEKFLQGTKKLYVNGSFIESASGKTFKTPNPATGETLAVVSEAGREDIH
KAVVAARMAFDEGPWSRMSTAERSRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAAD
IPLAIEHMRYYAGWATKIVGQTIPVSGDYFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLSALYLAELIEEAGFPKGVINIVPGFGESAGQALVNHPLVDKI
AFTGSTPVGKQIMRQASESLKRVTLELGGKSPNIILPDADLSRAIPGALSGVMFNQGQVC
SAGSRLFVPKKMYDNVMADLVLYSKKLNQGVGLNPETTIGPLVSEEQQKRVMGYIEKGIE
EGAEVLCGGSNPFDQGYFVSPTVFADVNDEMTIAKEEIFGPVISAIPFNDIDEVIERANK
SQFGLAAGVWTESVKTAHYVASKVRAGTVWVNCYNVFDAASPFGGFKQSGLGREMGSYAL
NNYTEVKSVWLNLN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactagctgtaaatcttcatgaaaaggtagaaaagtttcttcaaggtacaaaa
aagttatatgtgaatggatctttcattgaaagcgcttccggcaaaacatttaaaacacct
aacccagcaactggtgaaacacttgccgtcgtttctgaagctggtcgcgaagatattcat
aaagctgtagtcgcagctcgtatggcttttgacgaaggtccttggtctcgtatgagcact
gctgagcgaagccgtctcatgtacaagttagctgatctaatggaagaacataaagaagag
cttgcacagctcgaaacattagataacggaaaaccaatccgtgaaacaatggcagcagac
ataccacttgcaattgagcatatgcgctattacgctggatgggctacgaaaatcgttggt
caaacaattcctgtttccggtgattactttaactatacacgccatgaagctgttggtgtc
gttggtcaaattatcccttggaacttcccgcttcttatggcaatgtggaaaatgggagca
gcgcttgctacaggatgtacaatcgttttaaaacctgcagaacaaactccactatctgct
ctatacttagctgaattaattgaagaagctggattcccgaaaggtgttattaatatcgta
cctggattcggtgaatcagctggacaagctctcgttaatcatccactcgttgataaaatt
gcatttaccggttctactcctgtcggtaaacaaattatgcgacaagcatccgaatcatta
aaacgcgttacacttgaattaggcggtaaatcaccaaatatcatcttgccagatgctgat
ttatctcgcgcgattcctggtgcactttctggtgttatgtttaaccaaggacaagtatgc
tctgctgggtcacgcttatttgttccgaagaaaatgtatgataatgtcatggctgatctc
gtcctctattctaaaaaactaaatcaaggtgtcggtcttaaccctgaaacaacaattggt
cctctcgtttctgaagaacaacaaaaacgtgtaatgggctacatcgaaaaagggattgaa
gaaggcgctgaagtactttgcggaggtagtaatccattcgatcaaggctacttcgtttct
cctacagtattcgctgacgtaaatgatgaaatgacgatcgcaaaagaagaaattttcggt
ccagttatttctgcaataccatttaacgatattgatgaagtaattgaacgtgcaaataaa
tcacaattcggcttagcagctggtgtgtggacagaaagtgttaaaacagcacactatgtt
gcaagtaaagtacgtgctggtacagtatgggtaaactgttataacgtctttgatgcagca
tctccatttggaggatttaaacaatccggtcttggtcgtgaaatgggatcttatgcatta
aataactatacagaagtgaagagcgtttggcttaacttaaattaa

DBGET integrated database retrieval system