KEGG   Bacillus thuringiensis serovar thuringiensis IS5056: H175_ch5240Help
Entry
H175_ch5240       CDS       T02474                                 

Definition
(GenBank) Carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
btht  Bacillus thuringiensis serovar thuringiensis IS5056
Brite
Enzymes [BR:btht01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     H175_ch5240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH Peptidase_S9 UPF0227 DUF676 BAAT_C
Motif
Other DBs
NCBI-ProteinID: AGG03949
UniProt: M1QUN9
Position
complement(5102725..5103468)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPTDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacagggaactcagctgatgtacgtatgttagggcgtttcttagaa
aagaaaggctatacttgtcatgcgccaatttataaagggcacggtgtaccaccagaagag
cttgttcatacaggccctacagattggtggcaagatgtaacggaggcatatcagctttta
aaagataaaggttttgagaaaattgctgttgttggattgtcacttggcggcgtattttct
ttaaaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccgatgtat
attaagagcgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaaa
cgtgagcaaaaatcaccagaacaaattgaacaagaaatgttggaattccaaaagacaccg
atgaatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggatatg
atttatgcaccaacatttgttgtacaagcacgtcatgacgaaatgattaatacagatagt
gctaacattatttataacggtgtagaatctacgttaaaagacattaaatggtatgaagac
tctacgcatgtcattacacttgataaacaacgtgacgagctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system