KEGG   Bacillus thuringiensis YBT-1518: YBT1518_02145Help
Entry
YBT1518_02145     CDS       T02930                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00051  Fructose and mannose metabolism
bthu01100  Metabolic pathways
bthu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YBT1518_02145
Enzymes [BR:bthu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     YBT1518_02145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AHA69655
UniProt: V5M3E9
Structure
PDB: 

Position
465090..465731
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLADAAFEGMIDRRAVLLANHGLIAGANNIKMAFTIAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaaggggacgggcggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagtccaagtggtttagattattatgaaacaaagcctgaagatgtagttatatta
aacttagatggtgaagtagtagaaggagaaagaaagccatcaagtgaactagatatgcac
cttatttattatagaaagcgtgaagatataaatgcgcttgtacacacacattctccttat
gcaaagacgattgcatcattaggatgggaacttcctgcagtatcgtatttaattgctttt
gcaggcccgaatgtacgctgtgcgccgtatgagacatttggtacgaagcaattagcagat
gctgcttttgaaggcatgattgatcgccgtgcagtgttacttgcgaatcacggtttaatt
gctggggcaaataatataaaaatggcgtttactattgcagaagagattgaattttgtgct
caaatttattatcaaacaaaaagcgtcggagaaccgaagttactgccagaagacgagatg
gagaatttggcgaagaagtttgaagggtatgggcaacagtag

DBGET integrated database retrieval system