KEGG   Bacillus thuringiensis YBT-1518: YBT1518_06480Help
Entry
YBT1518_06480     CDS       T02930                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00860  Porphyrin and chlorophyll metabolism
bthu01100  Metabolic pathways
bthu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bthu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YBT1518_06480
Enzymes [BR:bthu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     YBT1518_06480
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     YBT1518_06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 HI0933_like Pyr_redox_2 DUF4988 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHA70498
UniProt: V5M8J4
Position
1327006..1328427
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSVMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMH
EGTIIKGTRIEKIAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PSTSVANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGAGLPDCINQGEEASKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcatcactggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgagcgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctc
ggcgatgaacttgtaaataatcaagccggtcaatcatttatccttgtaaacaatcggtta
cataaaatgccgaatggatcagtgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggctttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgtcttggaaacgaa
gtggttgaaaacttaatagaaccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatg
ttccaaacagtgaaaacaggtttagaatctatcgtaaaatctctcgaagcaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaaattgcaaaacagggtgatggttat
acgattactcttagtaacggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccatccacatccgttgccaatgtcgcacttgctttccaaaagtccgcaatccagcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacacgattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagagctcgttcagctc
gtactagaagatttaagaaagacgatggatattacagaggatccagagtttacaatcgta
agtcgctggaaagaagcgatgcctcaatatacagtaggccataacgagcgaatgaaaaag
ctcacaacatttatggagaaagagttgcctggtatatacttggcaggtagctcctatgct
ggtgctggacttccagattgtattaatcaaggtgaggaagcttcaaagcgtgtattatct
catttggagaaagtaatagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system