KEGG   Bacillus thuringiensis YBT-1518: YBT1518_07920Help
Entry
YBT1518_07920     CDS       T02930                                 

Definition
(GenBank) aminoglycoside phosphotransferase family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bthu  Bacillus thuringiensis YBT-1518
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bthu01504]
    YBT1518_07920
Enzymes [BR:bthu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     YBT1518_07920
Antimicrobial resistance genes [BR:bthu01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    YBT1518_07920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AHA70782
UniProt: V5M6T0
Position
complement(1600449..1601351)
Genome map
AA seq 300 aa AA seqDB search
MDSYKHYIKEALPNLSIHSYKQNEEGWDNVAIIVNDELLFRFPRKQEFAMRIPLEKELCT
ILTQSLQEIEVPQYHLIYKNESDEVPLCSYYTLIHGEPLKTEIVATLEDTELQAIITQLA
TFLAALHSIPLKSITALGFPIEKTLTYWKELQTKLNQYVTNNLTSFQKSALNRLFENFFA
CLATSKFQNTIIHADFTHHHILFNKQNKRISGVIDFGDAQIGDPAFDFAGLYYDFGHEFT
TSVYEQYSTLISHHDPLLIHRITTFYQYSPLLHNIIYNFESENELEFITSTEQLKTILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacattatataaaagaagctttgcctaatctttctatacattcatat
aaacaaaatgaagaaggttgggataatgtagcaattatagtaaatgatgagctactcttt
cgtttcccgcgaaaacaggaatttgcaatgcgaattccgttagaaaaagaactatgcaca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttataaaaat
gaatctgatgaggttcctctttgtagttactatactctcattcatggtgaaccattaaaa
acagaaatagttgccacgctggaggatacagagctgcaagcaattattacacaattagct
actttccttgctgctctacatagtattcctctaaaaagtattacagcgttaggattccct
attgaaaaaacacttacctactggaaagagctacaaactaaattaaatcagtatgttact
aacaatcttacttcgttccagaaatcagccttaaatcgtttattcgagaatttctttgcc
tgtctagctacatctaaatttcaaaatacaatcattcacgctgattttacacatcatcac
attttatttaacaagcagaacaaacgcatttcaggtgttatcgattttggtgatgcgcaa
attggcgatcctgcttttgattttgcaggactatattatgatttcggacatgagtttact
acatctgtatatgaacagtacagtacacttatttctcatcatgatccattactcattcac
cgcattactaccttttatcaatatagtcctttactacataatattatttataactttgaa
tcagagaatgaactcgaattcattacaagtacagaacaactaaaaacgatattacaggga
tga

DBGET integrated database retrieval system