KEGG   Bacillus thuringiensis YBT-1518: YBT1518_19895Help
Entry
YBT1518_19895     CDS       T02930                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00071  Fatty acid degradation
bthu00072  Synthesis and degradation of ketone bodies
bthu00280  Valine, leucine and isoleucine degradation
bthu00310  Lysine degradation
bthu00362  Benzoate degradation
bthu00380  Tryptophan metabolism
bthu00620  Pyruvate metabolism
bthu00630  Glyoxylate and dicarboxylate metabolism
bthu00640  Propanoate metabolism
bthu00650  Butanoate metabolism
bthu00900  Terpenoid backbone biosynthesis
bthu01100  Metabolic pathways
bthu01110  Biosynthesis of secondary metabolites
bthu01120  Microbial metabolism in diverse environments
bthu01130  Biosynthesis of antibiotics
bthu01200  Carbon metabolism
bthu01212  Fatty acid metabolism
bthu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YBT1518_19895
   00630 Glyoxylate and dicarboxylate metabolism
    YBT1518_19895
   00640 Propanoate metabolism
    YBT1518_19895
   00650 Butanoate metabolism
    YBT1518_19895
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YBT1518_19895
   00072 Synthesis and degradation of ketone bodies
    YBT1518_19895
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YBT1518_19895
   00310 Lysine degradation
    YBT1518_19895
   00380 Tryptophan metabolism
    YBT1518_19895
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YBT1518_19895
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YBT1518_19895
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YBT1518_19895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthu04147]
    YBT1518_19895
Enzymes [BR:bthu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YBT1518_19895
Exosome [BR:bthu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YBT1518_19895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHA73111
UniProt: V5MD32
Position
complement(3931050..3932141)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKEYEVQQLTTPLLTFLSKGIEREIDDVILGNVVGPGGNV
ARLSALEAGLGYHIPGVTIDRQCGAGLEAIRTACHLIQGGAGKCYIAGGVESTSTSPFQK
RARFSPGKIGDPDMGVAAEYVAERYNITREMQDEYACLSYKRTLQALEKGYIHDEIFSFN
GLLDESIKPEMNYERIIKRTKPAFLQNGTVTAGNSCGVNDGACAVLVMEEGQARKLGYKP
VLRFVRSAVVGVDPKLPGTGPIFAVNKLLNEMNVKVEDIDYFEINEAFASKVVACAKELQ
IPYEKVNVNGGAIALGHPYGASGAMLVTRLFYQAQRESMKYGIATLGIGGGIGIALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaggcgaaaagaacacctattggtaagaagaatgggatg
ttaaaagagtatgaagttcagcaattaacaacgccgcttcttacgtttttaagtaaaggg
attgagagggaaatagatgatgtcatattaggtaatgttgttgggccaggagggaatgtt
gcgagactatctgctttagaggcgggacttggctatcatattcctggtgtaacgattgat
cggcaatgtggtgctggtttagaagcaattcgaactgcgtgtcatctcattcaaggcggg
gcaggtaagtgttatatcgccgggggagtagagagtacaagtacgtcaccttttcaaaaa
agagcacgattttcacctggaaaaattggtgatcctgacatgggagtagcggctgaatat
gttgcggagcgttataatataacgagagaaatgcaagacgagtatgcttgtcttagttat
aagcggacactgcaagcgttagaaaaaggatatatacatgatgaaatattttcttttaat
ggattattagatgaatctataaagccagaaatgaattatgaacgaatcattaaaagaaca
aagcccgcatttttacaaaatggaacagtgacggcaggtaattcatgtggtgtaaatgat
ggggcatgtgctgttcttgtaatggaagagggacaagcccgaaagttaggttataaacct
gtccttcgtttcgttcgtagtgctgtagtgggagtggatcccaagcttccagggactggt
ccgatatttgcggtgaacaaattattaaacgaaatgaatgtaaaagtagaggacatcgat
tattttgaaataaatgaagcattcgcctcaaaagttgttgcttgcgcaaaagagttacaa
attccgtacgaaaaagtaaatgtaaatggtggagcaattgcgctcggtcatccgtacggt
gcatctggtgctatgcttgtaacacgtttgttttatcaggcacaaagagagtctatgaaa
tatggaattgctacattaggaattggaggcgggatagggattgcgctattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system