KEGG   Bacillus thuringiensis YBT-1518: YBT1518_27990Help
Entry
YBT1518_27990     CDS       T02930                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00450  Selenocompound metabolism
bthu00970  Aminoacyl-tRNA biosynthesis
bthu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    YBT1518_27990
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YBT1518_27990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bthu01007]
    YBT1518_27990
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bthu03016]
    YBT1518_27990
Enzymes [BR:bthu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     YBT1518_27990
Amino acid related enzymes [BR:bthu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   YBT1518_27990
Transfer RNA biogenesis [BR:bthu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YBT1518_27990
 Prokaryotic type
   Other AARSs
    YBT1518_27990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AHA74703
UniProt: V5MKG3
Position
complement(5448569..5450203)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKEIANKYHEEFQRCFRDLGFTYDCYTRTDSEHHHETVQKVFLRLLEEGYIYKKTV
EQAYCETCTQFLPDRYVEGICPYCHEAARGDQCDACSAILDPLDLLEKKCKLCGSTPSVE
ETEHFYFALHTFQEQIKKVVEIAKEKGTWRDNAIQLTERYVKEGLQDRAVSRDLPIGVSI
PVKGYEDKKIYVWIEAVAGYYSASKHWAEETGKDDQEFWNSDAQTYYVHGKDNIPFHSVI
WPAVLLGIGEEAIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYDPDSIRYFLTVNA
PENRDTDFSWREFIYSHNSELLGAYGNFVNRTLKFIEKYYDGTVPKGTIDIELKDKVEGL
YKNVGEAIEQTKFKVALETIFDAVRFANKYFDEKQPWKQREDDPVSCEETIYNCVYLIAN
FANLLEPFLPFSSERVRSTLSIIKRNWEPQNTLPSRIDSVQPLFERIDVKQIEHEIEKLY
GAVK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattggaggcgcttggccgtatgcaaatggttcgttacaccttggccat
attgcgagtttattacctggagatattttagcgcgttattacagggcaaaaggtgagaat
gtgctgtatgtttcagggagtgactgcaatggaacaccgattgcaattagagcaaaacaa
gaaggtgtgacagcaaaagaaattgctaataagtatcatgaagaatttcagcgatgtttt
cgtgatctcggttttacgtatgattgctatacacgtaccgatagcgagcatcatcatgaa
actgttcaaaaagtttttttacgtttattagaagaaggctatatttataaaaaaacagtg
gaacaagcgtattgtgaaacgtgtacgcagtttttaccggatcgttatgtagaaggaata
tgtccatattgccatgaagcagcaagaggagatcaatgcgatgcttgttctgctatttta
gatcctcttgatttgttagaaaagaaatgtaagttatgtggtagtacgccatctgtagag
gaaacagagcatttctattttgcattgcatacatttcaggagcaaattaaaaaagttgta
gaaatcgcaaaagaaaaaggaacatggcgtgataatgcaattcaattaacggaaagatac
gtaaaggaagggttacaagatagggctgtatcaagagatttaccaatcggggtatcaatt
ccagtgaaagggtatgaagataaaaaaatttacgtatggattgaagcagtggcaggatat
tattcagcgagtaaacattgggctgaagaaacaggaaaagatgatcaagagttttggaat
agcgatgcgcaaacatattatgtacacggcaaggataatattccatttcactccgtcatt
tggccagcggtattacttggaataggggaagaagcaatcccgcgtcatatcgtttcgaat
gaatatttaacagttgaaaaaagaaaattatctacaagtaaaaactgggcagtatgggta
cctgacatattagaacgctatgatccagattctatccgttacttcttaacagtaaatgca
ccagaaaatcgtgacactgatttttcatggcgtgaatttatttacagtcataatagtgaa
ttgttaggagcatatggaaacttcgtgaaccgcacattaaagtttattgaaaaatattat
gatggcactgtaccaaaggggactattgatatagagctgaaagataaagtagaaggatta
tataaaaatgtaggagaggcgattgagcaaactaaatttaaggtggcgttagagacaata
tttgatgcagtacgttttgcaaataaatattttgatgaaaagcagccttggaaacaaaga
gaagatgatccagtttcgtgtgaagaaacgatttataactgtgtgtatcttatcgctaat
tttgcaaatctccttgaaccgtttttaccattttcaagtgaaagagttagaagcacattg
tcgattattaaacgaaattgggaaccgcaaaatacgttgccaagtagaattgatagcgtg
cagccactatttgagcgaatcgatgtaaaacaaattgagcatgagatagagaagttatat
ggagcggtaaaatga

DBGET integrated database retrieval system