KEGG   Bacillus thuringiensis YBT-1518: YBT1518_30695Help
Entry
YBT1518_30695     CDS       T02930                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bthu  Bacillus thuringiensis YBT-1518
Pathway
bthu00230  Purine metabolism
bthu00250  Alanine, aspartate and glutamate metabolism
bthu01100  Metabolic pathways
Module
bthu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bthu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YBT1518_30695
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YBT1518_30695
Enzymes [BR:bthu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     YBT1518_30695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt Ribosomal_S5_C
Motif
Other DBs
NCBI-ProteinID: AHA75240
UniProt: V5MJF5
Position
complement(5982024..5983313)
Genome map
AA seq 429 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVFGGVKYKLHLIPSGIF
YKEKICVIGNGLVVDPKALLEELKYLHDRGVSTDNLRVSNRAHVILPYHLKQDELEEASK
GDNKIGTTKKGIGPAYMDKAARIGIRMADLLDREAFKEKLERNLVEKNRLFEKMYDTEGF
SVEEIFEEYFEYGQQIAQYVCDTSVVLNDALDNNHRVLFEGAQGVMLDIDHGTYPFVTSS
NPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELNDEIGHQIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTDIPTLKICVAYKYNGEVIDEVPANL
NILAKCEPVYEELPGWTEDITGVKSLDELPENARKYVERVCELTGIQLSMFSVGPDRNQT
NIVRNVYEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtagtagttgtaggaacacaatggggcgacgaaggaaaaggtaaaatcact
gattttctttctgagcatgcggaagtagttgcaagatatcaaggtggaaataacgcggga
catacaattgttttcggcggagttaaatataagttacacttaattccatctggtattttc
tataaagagaaaatttgtgtaatcggaaatggcttagtagtagatccgaaagcattactt
gaagagttaaaatacttacacgaccgtggtgtaagtactgataatttacgtgtaagtaac
cgtgcacacgttattttaccttatcacttaaaacaagatgagttagaagaggctagtaaa
ggtgataacaaaatcggtacaacgaaaaaaggtatcggtcctgcatatatggataaagct
gctcgtattggtatccgtatggctgatcttttagatcgtgaagcatttaaagagaagctt
gagcgcaatttagtagagaaaaatcgtttgtttgaaaaaatgtacgatacagaaggtttc
agtgtagaagaaatctttgaagagtacttcgaatatggacaacaaatcgcacaatatgta
tgcgacacatctgttgtattaaatgatgcactagataacaatcaccgtgtattatttgaa
ggtgcacaaggtgttatgcttgatattgaccacggtacgtacccattcgttacatcttct
aacccgattgcgggtggtgtaacagttggaactggagttggtcctgcgaaagttactcgc
gttgtaggtgtatgtaaagcatatacaagccgtgttggtgacggtccattccctactgaa
cttaatgatgaaattggtcatcaaattcgtgaagttggtcgtgagtacggaacaacaact
ggtcgtccgcgccgcgtaggttggttcgatagcgttgttgtaagacatgcgcgtcgtgtt
agtggtttaacggatctatcattaaattctatcgacgttttaacagatattccaactctt
aaaatttgtgttgcttacaaatacaatggcgaagttatcgatgaagttccagcaaactta
aacattttagcgaaatgtgagcctgtatatgaagagcttccaggttggacagaagatatt
actggtgtaaaatcattagacgagcttcctgaaaatgcacgaaaatacgtagaacgtgtt
tgtgagttaacaggaattcaattatctatgttctcagttggaccagatcgtaaccaaacg
aatattgttcgtaatgtatacgaagcttaa

DBGET integrated database retrieval system