KEGG   Bacillus thuringiensis YWC2-8: AQ980_05220Help
Entry
AQ980_05220       CDS       T04752                                 

Definition
(GenBank) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AQ980_05220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bthy01007]
    AQ980_05220
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bthy03016]
    AQ980_05220
   03029 Mitochondrial biogenesis [BR:bthy03029]
    AQ980_05220
Enzymes [BR:bthy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AQ980_05220
Amino acid related enzymes [BR:bthy01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AQ980_05220
Transfer RNA biogenesis [BR:bthy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AQ980_05220
Mitochondrial biogenesis [BR:bthy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AQ980_05220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ALL57267
UniProt: A0A0G3E5W4
Position
complement(951105..952481)
Genome map
AA seq 458 aa AA seqDB search
MYSMEQVVNLAKHRGFVFPGSEIYGGLANTWDYGPLGIELKNNVKKAWWKKFIQESPHNV
GLDAAILMNPKTWIASGHVGNFNDPMIDCKKCKARHRADKLIEDALDAKGIEMVVDGLTF
DQMADLMKEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNEIFLRPETAQGIFVNF
KNVQRSMRKKLPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGEDLEWFAFWR
ETCKNWLLSLGMSEESMRLRDHGEEELSHYSNATTDIEFKFPFGWGELWGVASRTDFDLK
RHMEHSNEDFNYIDPQTNERYVPYCIEPSLGADRVTLAFLCDAYEEEQLENDSRTVLRFH
PALAPYKAAILPLSKKLSEGATEVFAELAKDFMVDFDETGSIGKRYRRQDEIGTPFCITY
DFDSVEDKAVTVRDRDTMEQVRMPISELKGFLEKKIQF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtattcaatggaacaagttgtaaacttagcgaaacatcgcggttttgttttccctggt
tctgaaatttacggtggtcttgcaaacacttgggattacggtccacttggaatcgaatta
aaaaataatgttaaaaaagcttggtggaaaaaattcattcaagaatctccacacaacgtt
ggtttagacgcagctattttaatgaaccctaaaacttggatcgcttctggtcacgttggt
aacttcaacgatccaatgatcgactgtaaaaaatgtaaagctcgtcaccgtgctgacaaa
ttaattgaggatgctttagatgcaaaaggcatcgaaatggttgttgacggtcttactttc
gaccaaatggctgacttaatgaaagaacatgaagtaaaatgtcctgattgcggtagtgaa
gaatttactgaaatccgtcagttcaacttaatgttcaaaacattccaaggtgttacagag
tctagcacaaacgaaatcttccttcgtcctgaaacagcacaaggtattttcgtaaacttc
aaaaacgttcaacgctctatgcgtaaaaagcttccatttggtatcggccaaatcggtaag
agtttccgtaacgaaatcacacctggtaacttcacattccgtacacgtgaatttgaacaa
atggaacttgaattcttctgtaagcctggtgaagatttagagtggttcgcattctggcgt
gaaacttgtaaaaactggttactttcacttggtatgtctgaagagagcatgcgtcttcgt
gaccacggtgaagaagagttatctcactacagtaatgcaacaactgacattgaattcaaa
ttcccattcggttggggcgaactttggggcgttgcatctcgtacagacttcgacttaaaa
cgtcacatggaacactcaaacgaagactttaactatatcgatccacaaacgaatgagcgt
tacgtaccatactgcatcgagccatctttaggcgcagaccgcgtaacattagcattctta
tgtgatgcatatgaagaagagcaattagaaaacgattctcgtacagttcttcgtttccac
cctgctttagcaccatacaaagcagctatcttaccattatctaaaaagctatctgaaggt
gctactgaagtattcgcagaattagctaaagacttcatggtagactttgatgaaactggt
tctatcggtaaacgttaccgtcgtcaagacgaaatcggtacaccattctgtatcacatac
gacttcgactcagttgaagacaaagctgttacagtacgtgaccgtgacacaatggaacaa
gttcgtatgccaattagcgaactaaaaggtttcttagagaagaaaatccagttctaa

DBGET integrated database retrieval system