KEGG   Bacillus thuringiensis YWC2-8: AQ980_07800Help
Entry
AQ980_07800       CDS       T04752                                 

Gene name
aspS
Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AQ980_07800 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bthy01007]
    AQ980_07800 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bthy03016]
    AQ980_07800 (aspS)
   03029 Mitochondrial biogenesis [BR:bthy03029]
    AQ980_07800 (aspS)
Enzymes [BR:bthy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     AQ980_07800 (aspS)
Amino acid related enzymes [BR:bthy01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   AQ980_07800 (aspS)
Transfer RNA biogenesis [BR:bthy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AQ980_07800 (aspS)
 Prokaryotic Type
   Other AARSs
    AQ980_07800 (aspS)
Mitochondrial biogenesis [BR:bthy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AQ980_07800 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ALL57743
UniProt: A0A243G1X4
Position
1426059..1427834
Genome map
AA seq 591 aa AA seqDB search
MAERTHACGKVTVEAVGQTVQLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPETSKEAL
EVAETIRSEYVLHVEGTVVERGEGAINDNMATGRIEVQATKVNVLNAAKTTPIIIADDTD
ASEDVRLKYRYLDLRRPVMFNTFKMRHDVTKTIRNFLDTEEFLEVETPILTKSTPEGARD
YLVPSRVHDGEFYALPQSPQLFKQLLMVGGFERYYQVARCFRDEDLRADRQPEFTQIDIE
ASFLTQDEILDMMERMMTKVMKDAKGVEVSAPFPRMKYADAMARYGSDKPDTRFEMELTD
LSEFAAGCGFKVFTSAVESGGQVKAINAKGAASKYSRKDIDALTEFVKVYGAKGLAWLKV
EEDGLKGPIAKFFGEEDANVLMSTLEATAGDLLLFVADKKSVVADSLGALRLRLGKELEL
IDESKFNFLWVTDWPLLEYDEDADRYFAAHHPFTMPFREDVELLETAPEKARAQAYDLVL
NGYELGGGSLRIYERDVQEKMFKALGFSQEEAQEQFGFLLEAFEYGTPPHGGIALGLDRL
VMLLAGRTNLRDTIAFPKTASASCLLTEAPSPVAEAQLEELNLKLSLKEEK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagaacacatgcatgtggaaaagtaacagtagaagctgttggacaaacagtt
caattaaaaggttgggtacaaaaacgccgtgacttaggtggattaatctttatcgactta
cgtgaccgtacaggtatcgtgcaagttgtatttaacccagaaacatcaaaagaagcgtta
gaagtagcagaaacaattcgtagcgaatacgtattacacgtagaaggtacagttgttgaa
cgtggtgaaggcgcaattaatgacaatatggcaactggtcgtattgaagtacaagcaacg
aaagtaaatgtactaaatgcagcgaaaacaacgccaatcatcattgctgatgatacagat
gcatcagaagatgtgcgtttaaaatatcgttatttagacttacgtcgtccagtaatgttt
aacacattcaaaatgcgtcatgacgtaacgaaaacaattcgtaacttcttagacacagaa
gagttcttagaagtagaaacaccaattttaacgaaaagcacgccagaaggagctcgtgac
tatttagtgccaagtcgtgtacatgatggtgaattctatgcattaccacagtcaccacag
ttatttaaacagcttcttatggtcggcggatttgagcgttactatcaagtagcacgttgt
ttccgtgatgaagatttacgtgcggatcgtcaaccggaattcacgcaaatcgatatcgaa
gcttcattcttaacacaagatgaaattttagatatgatggagcgtatgatgacgaaagtt
atgaaggatgcaaaaggtgtagaagttagtgcaccattccctcgtatgaaatatgctgat
gcaatggctcgctacggttctgataagccagatacacgctttgaaatggaactaacagac
ttatctgagtttgcagcaggttgtggctttaaagtgtttacaagtgctgtagaaagcggc
ggacaagtaaaagcaatcaatgcaaaaggtgctgcaagtaaatattctcgtaaagacatc
gatgcattaactgaattcgtgaaagtatacggtgcaaaaggtttagcttggcttaaagtt
gaagaagacggtttaaaaggaccgattgcaaaattcttcggtgaagaagatgcaaatgtg
ttaatgagcacattagaggctactgctggcgacttattactattcgtagcagataagaag
agcgttgttgcagatagcttaggcgcacttcgtttacgtctaggtaaagagcttgagtta
attgatgaaagtaaatttaacttcctatgggtaactgattggccacttcttgagtacgat
gaagatgcagatcgttacttcgcagctcaccacccattcacaatgccattccgtgaagac
gttgagttactagaaacagcaccagaaaaagcacgtgcacaagcatatgaccttgtatta
aacggttatgagcttggtggtggctcacttcgtatttacgagcgtgacgtacaagaaaaa
atgtttaaagcacttggattctcacaagaagaagcgcaagagcaattcggattcttatta
gaagcattcgaatacggtacaccaccacacggcggtattgcattaggtttagatcgtctt
gttatgctgcttgcaggccgtacgaaccttcgtgatacaattgcattcccgaaaacagca
agcgcaagctgcttattaacagaagctccaagcccagttgcagaagcacagcttgaagag
ttaaacttaaaattaagcttaaaagaagagaagtaa

DBGET integrated database retrieval system