KEGG   Bacillus thuringiensis YWC2-8: AQ980_09800Help
Entry
AQ980_09800       CDS       T04752                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00071  Fatty acid degradation
bthy00072  Synthesis and degradation of ketone bodies
bthy00280  Valine, leucine and isoleucine degradation
bthy00310  Lysine degradation
bthy00362  Benzoate degradation
bthy00380  Tryptophan metabolism
bthy00620  Pyruvate metabolism
bthy00630  Glyoxylate and dicarboxylate metabolism
bthy00640  Propanoate metabolism
bthy00650  Butanoate metabolism
bthy00900  Terpenoid backbone biosynthesis
bthy01100  Metabolic pathways
bthy01110  Biosynthesis of secondary metabolites
bthy01120  Microbial metabolism in diverse environments
bthy01130  Biosynthesis of antibiotics
bthy01200  Carbon metabolism
bthy01212  Fatty acid metabolism
bthy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AQ980_09800
   00630 Glyoxylate and dicarboxylate metabolism
    AQ980_09800
   00640 Propanoate metabolism
    AQ980_09800
   00650 Butanoate metabolism
    AQ980_09800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AQ980_09800
   00072 Synthesis and degradation of ketone bodies
    AQ980_09800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AQ980_09800
   00310 Lysine degradation
    AQ980_09800
   00380 Tryptophan metabolism
    AQ980_09800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AQ980_09800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AQ980_09800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AQ980_09800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthy04147]
    AQ980_09800
Enzymes [BR:bthy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AQ980_09800
Exosome [BR:bthy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AQ980_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALL58122
UniProt: A0A0G3E9Q3
Position
1775912..1777087
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGHFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacagcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggagtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggacactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgagcatccacgtgca
gatattacagcggaaaaattagcaggattaaaaccagcattccgtaaagatgggtctgta
actgcaggtaatgcatctggcctgaatgacggaagtgcagttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagacccgaaaattatgggtattggaccagcaccagcaattcgtaaaggtttagaa
aaagtagattggtcattggaagatgcagatttacttgaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggcttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system