KEGG   Bacillus thuringiensis YWC2-8: AQ980_19815Help
Entry
AQ980_19815       CDS       T04752                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00330  Arginine and proline metabolism
bthy00360  Phenylalanine metabolism
bthy00380  Tryptophan metabolism
bthy00627  Aminobenzoate degradation
bthy00643  Styrene degradation
bthy01100  Metabolic pathways
bthy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AQ980_19815
   00360 Phenylalanine metabolism
    AQ980_19815
   00380 Tryptophan metabolism
    AQ980_19815
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AQ980_19815
   00643 Styrene degradation
    AQ980_19815
Enzymes [BR:bthy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     AQ980_19815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALL59991
Position
complement(3819659..3821134)
Genome map
AA seq 491 aa AA seqDB search
MEIQFNPILKKELTIQDIQNEMESGKLTSKELVMYYLYRIAKYDQDGPKINSILEINPDA
IFIAEALDYERKTKGIRGPLHGIPVLLKDNIETNDSMHTSAGTIALEQNISSEDAFLVTQ
LREAGAVIIGKTNMTELANAMSFEMWAGYSAKGGQTINPYGTGKDHMFVGGSSTGSAIAV
AANFTVVSVGTETDASILSPAVQNSVVGIKPTVGLISRRGIIPFTYSQDTAGPFARTVTD
AAILLGSLTGVDEKDVVTRKSENRAYRDYTSYLDANGLNGAKIGVFNDAPKDYYENGEYD
EILFKETIQVLRNEGATVVENIDIPSFHREWSWGVPLYELKHSLDNYLSKLPSTIPVHSI
SELMEFNKNIAERALKYGQTKLEGRKDFPNTLRNPEYLNARLEDIYFSQEQGIDFALEKY
NLDAILFPSYIGSTICAKAGYPSIAIPAGYMESGRPFGITIASTAFSEGILIKLAYAFEQ
ATKHRKILNLS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcagtttaatccaatcttaaaaaaggaattaacaattcaagatattcaaaat
gaaatggaatcaggaaagttaacttcaaaagagctagtgatgtattatctttatagaatc
gcaaagtatgatcaagacggaccgaaaatcaattcaattttagaaatcaatccagatgca
atttttattgcagaagcgttagattatgaaagaaagacaaaaggtataaggggtccatta
catggaatacctgttttgcttaaggataatattgaaacgaatgactccatgcatacaagt
gcaggtacaatagctctagaacaaaatataagcagtgaagatgcatttctcgttactcaa
ctgcgagaagcaggggcagtgataattggaaaaacgaatatgacagaattagcaaatgca
atgtcttttgaaatgtgggctggatatagtgcaaaaggtggtcaaacaatcaatccatac
ggaacgggcaaggatcatatgtttgttggcggatctagtacaggatctgcgatagcagtt
gctgctaactttacagtagtatctgttgggacagaaaccgatgcttctattttgagcccc
gctgttcaaaattctgtagtaggtattaaaccgactgtcggtttaattagtcgtagagga
attattccatttacttattcacaagatacagctggaccatttgctagaacggtaacagat
gctgctattttgctagggagtttaactggagtggatgagaaagatgtagttactcgaaaa
agtgaaaatagggcatatcgggattatacatcttaccttgatgcaaatggtttaaatgga
gcgaagattggtgtgtttaacgatgcaccaaaagattattacgaaaatggtgagtatgat
gaaatcttgtttaaggaaacgattcaagtattacgtaatgaaggagcgacagtagtagaa
aatattgatattccttcttttcatagagaatggagctggggagttccgctttatgagctg
aagcatagtttagataactatctttctaaattaccttctactatcccggtacattctatt
tcggagttaatggagtttaataaaaacatagcagaaagagctttaaaatatggacaaact
aagttagagggaagaaaagattttcctaatactttacgaaatccagaatatttaaatgcg
agattagaagatatatatttttctcaagaacaaggcattgattttgcattggaaaaatat
aatcttgatgcgatactgtttccttcctatataggttctactatatgtgcaaaagcgggt
tatccgtctatagcaataccagcagggtatatggaaagcgggaggccttttggaattacc
attgcaagcactgcctttagtgaagggatattaattaaattagcttatgcttttgaacaa
gcgacaaagcatagaaaaatcctcaacttatcatga

DBGET integrated database retrieval system