KEGG   Bacillus thuringiensis YWC2-8: AQ980_22960Help
Entry
AQ980_22960       CDS       T04752                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00473  D-Alanine metabolism
bthy01100  Metabolic pathways
bthy01503  Cationic antimicrobial peptide (CAMP) resistance
bthy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AQ980_22960
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AQ980_22960
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AQ980_22960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bthy01504]
    AQ980_22960
Enzymes [BR:bthy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     AQ980_22960
Antimicrobial resistance genes [BR:bthy01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    AQ980_22960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ALL60588
UniProt: A0A0B5XM99
Position
4418608..4418847
Genome map
AA seq 79 aa AA seqDB search
MAEFKEQVLDILEEVCENDIVKENLDVQLFEEGILDSFAVVSLLVEFQERLDIEVSISDF
DRDEWATPNMVIKKLEEIR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaaagagcaagtattagatattttagaagaagtatgtgaaaacgatatt
gtgaaagaaaacttagatgttcaattatttgaagaaggtattcttgattcttttgctgta
gtatctttattagttgaattccaagagcgtttagatattgaagtttctatttctgatttt
gaccgtgacgagtgggctacaccaaacatggttattaaaaagttggaagaaatccgatga

DBGET integrated database retrieval system