KEGG   Bacillus thuringiensis YWC2-8: AQ980_29195Help
Entry
AQ980_29195       CDS       T04752                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bthy  Bacillus thuringiensis YWC2-8
Pathway
bthy00970  Aminoacyl-tRNA biosynthesis
bthy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AQ980_29195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bthy03029]
    AQ980_29195
Enzymes [BR:bthy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AQ980_29195
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AQ980_29195
Mitochondrial biogenesis [BR:bthy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AQ980_29195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln Baculo_F
Motif
Other DBs
NCBI-ProteinID: ALL61748
UniProt: A0A0B6BLM2
Position
complement(5580607..5580897)
Genome map
AA seq 96 aa AA seqDB search
MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTDVKPTTHVLTMK
NVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaagaatttccgttgagaatgtaaagcacgtagcacatttagcacgtcttgcaatt
actgatcaagaagcagaaaaatttcaaaaacaactagatgcaattgttacatttgcagaa
cagttaaatgaattagatacaacagatgtaaaaccaacaactcatgtattaactatgaaa
aatgttatgcgtgaagatgtaccagaaaaaggtttaccagtcgaagaagtattaaaaaat
gcaccggatcacaaagataatcaaatccgtgttccagcagtattagaatag

DBGET integrated database retrieval system