KEGG   Bacillus thuringiensis HD-771: BTG_01610Help
Entry
BTG_01610         CDS       T02293                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00010  Glycolysis / Gluconeogenesis
bti00053  Ascorbate and aldarate metabolism
bti00071  Fatty acid degradation
bti00280  Valine, leucine and isoleucine degradation
bti00310  Lysine degradation
bti00330  Arginine and proline metabolism
bti00340  Histidine metabolism
bti00380  Tryptophan metabolism
bti00410  beta-Alanine metabolism
bti00561  Glycerolipid metabolism
bti00620  Pyruvate metabolism
bti00625  Chloroalkane and chloroalkene degradation
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01120  Microbial metabolism in diverse environments
bti01130  Biosynthesis of antibiotics
Module
bti_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTG_01610
   00053 Ascorbate and aldarate metabolism
    BTG_01610
   00620 Pyruvate metabolism
    BTG_01610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTG_01610
   00561 Glycerolipid metabolism
    BTG_01610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTG_01610
   00310 Lysine degradation
    BTG_01610
   00330 Arginine and proline metabolism
    BTG_01610
   00340 Histidine metabolism
    BTG_01610
   00380 Tryptophan metabolism
    BTG_01610
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTG_01610
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTG_01610
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTG_01610
Enzymes [BR:bti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BTG_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFQ13829
UniProt: J7I112
Position
complement(324931..326415)
Genome map
AA seq 494 aa AA seqDB search
MSQLAVNLHEKVENFLQGTKKLYVNGSFIESASGKTFKTPNPATGETLAVVSEAGREDIH
KAVVAARMAFDEGPWSRMSTAERSRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAAD
IPLAIEHMRYYAGWATKIVGQTIPVSGDYFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLSALYLAELIEEAGFPKGVINIVPGFGESAGQALVNHPLVDKI
AFTGSTPVGKQIMRQASESLKRVTLELGGKSPNIILPDADLSRAIPGALSGVMFNQGQVC
SAGSRLFVPKKMYDNVMADLVLYSKKLNQGAGLSPETTIGPLVSEEQQKRVMGFIEKGIE
EGAEVLCGGNNPFDQGYFVSPTVFADVNDEMTIAKEEIFGPVISAIPFNDIDEVIERANK
SQFGLAAGVWTENVKTAHYVASKVRAGTVWVNCYNVFDAASPFGGFKQSGLGREMGSYAL
NNYTEVKSVWLNLN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactagctgtaaatcttcatgaaaaggtagaaaattttcttcaaggtacaaaa
aagttatatgtgaatggatctttcattgaaagcgcttccggaaaaacatttaaaacacct
aacccagcaactggtgaaacacttgccgtcgtttctgaagctggtcgtgaagatattcat
aaagctgtagtcgcagctcgtatggcttttgacgaaggtccttggtctcgtatgagcact
gctgagcgaagccgtctcatgtacaagttagctgatttaatggaagaacataaagaagag
cttgcacagctcgaaacattagataacggaaagccaatccgtgaaacaatggcagcagac
ataccacttgcaattgagcatatgcgctattacgctggctgggctacgaaaatcgttggt
caaacaattcctgtttccggtgattactttaactatacacgccatgaagctgttggtgtc
gttggtcaaattatcccttggaacttcccgcttcttatggcaatgtggaaaatgggagca
gcgcttgctacaggatgtacaatcgttttaaaacctgcagaacaaactccactatctgct
ctatacttagctgaattaattgaagaagctggattcccgaaaggtgttattaatatcgta
cctggattcggtgaatcagctggacaagctctcgttaatcatccactcgttgataaaatt
gcatttaccggttctactcctgtcggtaaacaaattatgcgacaagcatccgaatcatta
aaacgcgttacacttgagttaggcggtaaatcaccaaatatcatcttgccagatgctgat
ttatctcgcgcgattcctggtgcactttctggtgttatgtttaaccaaggacaagtatgc
tctgctggatcacgcttatttgttccgaagaaaatgtatgataatgtcatggctgatctc
gtcctttattctaaaaaattaaatcaaggcgctggtctaagtccagaaactacaatcggt
cctctcgtttccgaagaacaacaaaaacgtgtaatgggcttcattgaaaaagggattgaa
gaaggcgctgaagtactttgcggaggaaataatccattcgatcaaggctacttcgtttct
cctacagtattcgctgacgtaaatgacgaaatgacgatcgcaaaagaagaaattttcggt
ccagttatttctgcaataccgtttaacgatattgatgaagtaattgaacgtgcgaataaa
tctcaatttggcttagctgctggtgtatggacagaaaatgttaaaactgcacactatgtt
gcaagtaaagtacgtgcaggtacagtatgggtaaactgttataacgtctttgatgcagca
tctccatttggaggatttaaacaatctggtctcggccgtgaaatgggatcttacgcatta
aataactatacagaagtgaagagcgtttggcttaacttaaattaa

DBGET integrated database retrieval system