KEGG   Bacillus thuringiensis HD-771: BTG_04540Help
Entry
BTG_04540         CDS       T02293                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00020  Citrate cycle (TCA cycle)
bti00620  Pyruvate metabolism
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01120  Microbial metabolism in diverse environments
bti01130  Biosynthesis of antibiotics
bti01200  Carbon metabolism
Module
bti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTG_04540
   00620 Pyruvate metabolism
    BTG_04540
Enzymes [BR:bti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BTG_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like Pyr_redox TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AFQ14405
UniProt: J3ZVY1
Position
complement(923334..924836)
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKSDGSIDIGKAVKVNEQFQLSRQFWAYLVKSKLIRNPQDFIMPLPHMSLV
QGEKNVEFLKNRFEALSKNPLFQGMEFSDAPETLKKWLPLIMEGRTSNEPMAATKIDSGT
DVNFGALTRMLFDYLKTKNVELNYKHSVENIKRTKNGLWEVKVHDMNSGKIEHHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNQKVVEQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEVGLTKY
LIQQVMLSHEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPSRMVEWEEKIKEMIPSYGISLTENPRLFQ
DLHTSTGRTLGLNEKETVHN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgcaggaattatgagtgca
acgttaggctcattactaaaagaattagcacctgaatgggaaattaaagtttttgaaaaa
ctcgcaagtgccggggaagaaagctctaacgaatggaataatgcaggtacagggcattct
gcgctatgcgaactgaactatacttccgaaaaatctgacggatctatagatattggtaag
gctgtaaaagtgaatgagcaattccagctttcaagacaattttgggcatatcttgtaaaa
agcaaattaattcgtaatccacaagattttattatgccactacctcatatgagtttagta
caaggggaaaaaaatgttgagtttctaaaaaaccgttttgaagcgctttcaaaaaatcca
ctgtttcaaggaatggaattttccgacgctcctgaaacattaaaaaaatggcttccactc
attatggaaggccgtacatctaatgaaccgatggcggcaacgaagattgactctggaaca
gatgttaacttcggtgcattaacacgtatgttgtttgattacttaaaaacgaaaaatgtc
gagctaaactacaagcatagtgttgaaaatattaagcgcacgaaaaatggtttgtgggaa
gtgaaagtacacgatatgaatagtggtaaaattgagcatcatactgctaaattcgtcttt
attggcggtggtggcggtagtctacctctacttcaaaagactggtatccctgaatcaaag
catatcggtggattcccagtaagtggactatttatggtatgtaaaaaccaaaaagttgta
gagcaacatcatgcgaaagtatacggtaaagctaaagttggcgctccgccaatgtctgta
cctcaccttgatacgagatatatagataataaaaaagctttattattcggaccattcgca
gggttctcacctaaattcttaaaaactggctcaaatcttgacttaatcggttctgtaaaa
ccgaataacgtcttaacgatgttagctgctggtgtaaaagaagtgggacttacaaaatac
ttaattcagcaagttatgttatcgcacgaaaaacgcatggaagaattacgcgaattcatt
ccgaacgcgaaaagtgaagattgggatattgtagttgctggacaacgtgtacaagtaatt
aaagatactgatgctggcggtaaaggaacacttcaatttggtacagaagtagtaagtgca
gctgacggctcaatcgccgcattactaggcgcatcaccaggtgcttctactgctgttcac
gtcatgcttgaagtattagaaaaatgtttcccaagccgcatggtagaatgggaagaaaaa
ataaaagaaatgattccttcatatggcatttcactaactgaaaatccaaggttgttccaa
gacctacacacttctacaggtcgtacgcttggattaaatgaaaaagaaacagttcataac
taa

DBGET integrated database retrieval system