KEGG   Bacillus thuringiensis HD-771: BTG_13185Help
Entry
BTG_13185         CDS       T02293                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00790  Folate biosynthesis
bti01100  Metabolic pathways
Module
bti_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTG_13185 (folE)
Enzymes [BR:bti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BTG_13185 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: AFQ16089
UniProt: J3ZSM1
Position
complement(2588481..2589050)
Genome map
AA seq 189 aa AA seqDB search
MEKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcgatt
ggggatgatccaaatcgtgagggagtacttgatacaccaaaacgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagagcatttgcataaagtattcgga
gaagatcacgaagagcttgtactagtaaaagatataccattttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggtggaaaggtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtattagagcctcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgtggtgtgaaaaaaccaggt
gcgaaaacagtaacgacagcagtgcgtggtgtgcttgaaaatgatgctgcagcgcgcagt
gaaattttatcgtttattaaaacgaagtaa

DBGET integrated database retrieval system