KEGG   Bacillus thuringiensis HD-771: BTG_13850Help
Entry
BTG_13850         CDS       T02293                                 

Definition
(GenBank) aminoglycoside phsophotransferase
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bti  Bacillus thuringiensis HD-771
Brite
KEGG Orthology (KO) [BR:bti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bti01504]
    BTG_13850
Enzymes [BR:bti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BTG_13850
Antimicrobial resistance genes [BR:bti01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BTG_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase DUF1679 Baculo_ME53
Motif
Other DBs
NCBI-ProteinID: AFQ16222
UniProt: J3WZB0
Position
2707333..2708235
Genome map
AA seq 300 aa AA seqDB search
MDSYKHYIKEALPNLSIRSYKQNKGGWDNVAVIVNDELLFRFPRKQEYAMRIPLEKELCT
ILTQSLQEIKVPQYHLIYKNESDEVPLCSYYTLIHGEPLKTETIATLEDTELKAIITKLA
TFLAVLHSIPLNQVTTLCFPIRKTCTYWKELQTKLNQYLTTNLTSLQKLALNRLFENFFA
CLATSTFQNTIIHADFTHHHILFNKQNKSISGVIDFGDAQIGDPAFDFAGLYYDFGHEFT
TSVYEQYSTLISHHDPLLIHRITTFYQYSPLLHNIIYNFESENELEFITSTEQLKTILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacattatataaaagaagctttgcctaatctttctatacgttcatat
aaacaaaataaaggaggatgggataatgtagcagttatagtaaatgatgagctactgttt
cgtttcccgcgaaaacaggaatatgcaatgcgaattccgttagaaaaagaactatgcaca
attctcactcaatcactacaagaaatcaaagttccacaatatcacctaatttataaaaat
gaatctgatgaggttcctctttgtagttactatactctcattcatggtgaaccattaaaa
acagaaacaattgccacgctggaggatacagagctgaaagcaattattacaaaattagct
actttccttgcggtactacatagtattcctttaaaccaagttacaacgctatgtttccct
attagaaaaacatgtacctactggaaagagctacaaacaaaattaaaccaatatctcact
actaaccttacttcattacagaaactagccttaaatcgcttatttgaaaatttctttgca
tgtttagctacatccacttttcaaaacacaatcattcacgctgattttacacatcatcac
attttatttaacaagcagaacaaaagcatttcaggtgttatcgattttggtgatgcgcaa
attggcgatcctgcttttgattttgcaggactatattatgatttcggacatgagtttact
acatctgtatatgaacagtacagtacacttatttctcatcatgatccattactcattcac
cgcattactaccttttatcaatacagtcctttactacataatattatttataactttgag
tcagagaatgaactcgaattcattacaagtacagaacagctaaaaacgatattacaggga
tga

DBGET integrated database retrieval system