KEGG   Bacillus thuringiensis HD-771: BTG_18670Help
Entry
BTG_18670         CDS       T02293                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00220  Arginine biosynthesis
bti00250  Alanine, aspartate and glutamate metabolism
bti00471  D-Glutamine and D-glutamate metabolism
bti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTG_18670
   00220 Arginine biosynthesis
    BTG_18670
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BTG_18670
Enzymes [BR:bti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BTG_18670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TIMELESS
Motif
Other DBs
NCBI-ProteinID: AFQ17164
UniProt: J3ZUL9
Position
3652757..3653686
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKESEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatataca
aaaaaaggaaaacttgctacttatatccccgaactaggaaatgcaaatccagacgattta
gggattgccattttccataaagaatcagaatatatccatgcaggcaactcacaaacacta
tttactcttcaaagtatttccaaagtaattacacttgctcttgcccttttagaccgtggc
gaagaatatgtattttctaaagttggaatggaaccaacgggtgacccatttaattctatt
attaagttagaaacgacaagtccgtccaaaccccttaatccaatgattaatgcaggagca
ttagctattacaagcatgttagcaggaaaagataacgaggaaaaaatggagcgtatcctt
cattttgtacgtgaaataacagataatcctactattaattattcttctaaagttgccaat
tcagaattagagacagcttacttaaatcgttcactttgttactatatgaaacaaaacgga
attatcgattgtgacatcgaagaacttatggatttatacactcgtcaatgtgcagttgaa
gtaaactgtattgatttagcacgtattggcttaatttttgcaatggatggatatgatcca
tataaaaagaaacagattatccctaaacatattacaaaaatttgcaaaacatttatggtc
acatgtggtatgtataacgaatctggtgaatttgcaatccgtgttggtatccctgcaaaa
agtggtgtagccggtggcattttcggctgcgtaaaaggtgaaatgggaatcggtattttc
gggccagctttagatgcaaacggaaatagtatcgctggttttaaaattcttgaacttctt
tctgctcaagaaggctggagtattttttaa

DBGET integrated database retrieval system