KEGG   Bacillus thuringiensis HD-771: BTG_24045Help
Entry
BTG_24045         CDS       T02293                                 

Definition
(GenBank) 4-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00627  Aminobenzoate degradation
bti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTG_24045
Enzymes [BR:bti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BTG_24045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Isochorismatase DUF4332
Motif
Other DBs
NCBI-ProteinID: AFQ18221
UniProt: J3USG3
Position
4724634..4725398
Genome map
AA seq 254 aa AA seqDB search
MYKGYLIDLDGTMYRGEEQIEEASDFVKALGERGIPYLFVTNNSTRKPEQVAEKLVRFDI
PAKAEQVFTTSMATANFIYERKQDATVYMIGEEGLHDALVEKGFELVDENPDFVVVGLDR
DITYEKLAKACLAVRNGATFISTNGDIAIPTERGLLPGNGSLTSVVAVSTGVDPIFIGKP
ESIIMEQALKVLGIGKDEALMVGDNYDTDILAGVNAGMHTLLVHTGVTTVEKLTEYEVQP
TQVVHNLTEWIEKM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggttacttaattgacttagacggtacgatgtatcgcggggaagaacaaatt
gaagaagcaagcgacttcgtcaaagcattaggagagcgcggcattccatatttattcgtt
acgaataactcaactcgcaaaccagaacaagtggcagaaaagcttgttcgtttcgatatt
ccagcgaaagcggagcaagtattcacaacgagtatggcgactgcgaacttcatttatgaa
cgtaaacaagatgcaactgtatatatgattggtgaagaaggcttacacgatgcacttgtg
gaaaaaggatttgaacttgtggatgaaaatcctgatttcgttgttgttggtttagatcgt
gacatcacatatgaaaaattagcaaaagcgtgtcttgctgtgcgtaacggcgcgacgttt
atttctacaaatggagacattgccattccgactgagcgcggattgttaccaggtaacggc
tcattaacatcagttgtagcagtatcaacaggtgtggatccaatctttatcggaaaacca
gaatcaatcatcatggaacaagcgttaaaagttcttggtataggaaaagatgaagcatta
atggttggggataactatgatacagacattttagcgggagtaaatgctggcatgcatacg
cttcttgtccacactggagtcacaactgtggagaagttaacagaatatgaagtacaacca
acgcaagttgtgcataacttgacggagtggattgagaagatgtaa

DBGET integrated database retrieval system