KEGG   Bacillus thuringiensis HD-771: BTG_25270Help
Entry
BTG_25270         CDS       T02293                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00030  Pentose phosphate pathway
bti01100  Metabolic pathways
bti01120  Microbial metabolism in diverse environments
bti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTG_25270
Enzymes [BR:bti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BTG_25270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase
Motif
Other DBs
NCBI-ProteinID: AFQ18459
UniProt: J3ZWC9
Position
4952143..4952928
Genome map
AA seq 261 aa AA seqDB search
MYSDLAGKVVVITGSATGLGRAMGVRFAKEKAKVVINYRSRESEANGVLEEIKKVGGEAI
AVKGDVTVESDVVNLIQSAVKEFGTLDVMINNAGIENAVPSHEMPLEDWNRVINTNLTGA
FLGSREAIKYFVEHDIKGSVINMSSVHEKIPWPLFVHYAASKGGIKLMTETLALEYASKG
IRVNNIGPGAINTPINAEKFADPKQRADVESMIPMGYIGKPEEIAAVATWLASSEASYVT
GITLFADGGMTLYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgatttagcagggaaagttgtcgttattacaggatcagcaactggtctcgga
agagcgatgggagtgaggtttgctaaggaaaaagcgaaagtggttattaattatcgctca
cgagaatcagaagcaaatggtgtgttagaagaaattaaaaaggtaggcggcgaagcgatt
gctgtaaaaggtgatgtaacggtcgaatcagatgttgtgaatctcattcaatctgctgtg
aaagagtttggtacgcttgacgttatgattaataatgcagggatagaaaacgcggtaccg
tcgcatgaaatgccgcttgaagattggaatagggtaattaatacaaatttaacaggtgct
tttttaggaagtcgtgaagcgattaaatattttgtagaacatgatattaaagggtctgtc
attaatatgtctagtgttcatgagaaaattccgtggccactatttgtgcactatgcagca
agtaagggtggtattaaactgatgacagaaacgttagcgctagaatatgcgtcaaaaggt
attcgagtaaataatattgggccaggtgcaattaatacgccgataaatgcagaaaaattt
gctgatccaaagcagcgtgctgacgtagaaagtatgataccgatgggctatattggaaaa
cctgaagaaattgcagcggtagcaacttggcttgcttcttcagaggcgagttatgtaacg
ggaattacgctatttgcagatggtggaatgacgttatatccatcgtttcaagctgggcgt
gggtaa

DBGET integrated database retrieval system