KEGG   Burkholderia thailandensis E444: BTJ_1879Help
Entry
BTJ_1879          CDS       T03112                                 

Gene name
glyQ
Definition
(GenBank) glycine--tRNA ligase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:btj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTJ_1879 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btj01007]
    BTJ_1879 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btj03016]
    BTJ_1879 (glyQ)
Enzymes [BR:btj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     BTJ_1879 (glyQ)
Amino acid related enzymes [BR:btj01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BTJ_1879 (glyQ)
Transfer RNA biogenesis [BR:btj03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BTJ_1879 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AHI79881
Position
1:2147362..2148369
Genome map
AA seq 335 aa AA seqDB search
MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRP
KDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGFDLKQNDVRFVEDDWENPT
LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIW
TEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEAKRMIEAQ
LALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYDSREKLGFPMI
GNPVPGVPGLTTDAQEAAQPAWAPPLKAERKIDQD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgtttcagcaaatcatcctgacgctccagtcctattgggacaggcagggttgc
gccctgctccagccgatcgacatggaagtcggcgccggcacgtcgcacgtgcacacgttc
ctgcgcgcgatcggccccgagccgtggcgcgccgcgtacgtgcagccgtcgcgccgcccg
aaggacggccgctacggcgagaacccgaaccgcctgcagcactactaccagtaccaggtg
gtgctcaagcccgcgccggagaacatcctcgatctgtatctcggctcgctggcagcgctc
ggcttcgacctgaagcagaacgacgtgcgcttcgtcgaggacgactgggaaaacccgacg
ctcggcgcatggggcctcggctgggaagtgtggctgaacggaatggaagtcacgcagttc
acgtacttccagcaggtgggcggcctcgactgcaagcccgtgctcggcgagatcacctat
ggcctcgagcgcctcgcgatgtatctgcagaaggtcgagaacgtctacgacctgatctgg
accgagtgggaggagcagggcccgaacggccccgagatccgccgtctgacgtacggcgat
gtctaccaccagaacgaagtcgagcagtcgacgtacaacttcgagcaggcgaacgtcgag
ctgctcttcacgttcttcaacagctacgaggccgaggcgaagcggatgatcgaagcgcag
ctcgcgctgcccgcatacgaactcgtgctgaaggccggccacacgttcaacctgctcgac
gcgcgcggcgcgatctccgtgaccgagcgcgccgcgtacatcggccgcatccgcgcgctg
tcgcggctcgtcgcgcaggcgtactacgattcgcgcgagaagctcggcttcccgatgatc
ggcaacccggtgccgggcgtgccgggcttgaccaccgacgcgcaggaggccgcgcagccc
gcatgggccccgccgctgaaagccgaacgcaagatcgatcaggactga

DBGET integrated database retrieval system