KEGG   Burkholderia thailandensis E444: BTJ_3085Help
Entry
BTJ_3085          CDS       T03112                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00051  Fructose and mannose metabolism
btj00520  Amino sugar and nucleotide sugar metabolism
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTJ_3085
   00520 Amino sugar and nucleotide sugar metabolism
    BTJ_3085
Enzymes [BR:btj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BTJ_3085
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BTJ_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 IspD AraC_binding Cupin_1
Motif
Other DBs
NCBI-ProteinID: AHI77479
Position
1:complement(3474472..3475902)
Genome map
AA seq 476 aa AA seqDB search
MNIHPVILCGGSGTRLWPMSRGGYPKQYLKLAGNTTLVQQTALRVRDVEGVGAPIVVTNN
EQRFLVAEQLRQVGITPSSIVLEPMGRNTAPAIAIAALLALRESPDALLLVLPSDHVIDN
ETAFVDVVKTAASVASDAHLVTFGVTPTQAHTGYGYIRRGEAFAGDTRVYRVDAFVEKPD
APAAERFIADGGYYWNSGMFMLKASTYLDELRRHAPDIANQAELALGAAKRDHDFLRLDP
EAFGASPNVSIDYAVMEKTERAAVVAAANLGWNDIGSWSALADIAATDAQRNALIGDVYT
DAVENSYIRAEHRMVAALGLDNIVIVETADAVLVAHRDRAQDVKKVVEWLNASGRRESVT
HRRVIRPWGAYEGIDQGERFQVKRIVVNPGAQLSLQMHHHRAEHWIVVKGTALVTNDGKE
IILTENQSTYIPLGTTHRLKNPGKIPLELIEVQSGSYLGEDDIVRFEDTYGRTSAT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatccggtgatcctgtgcggcggcagcggcacacgcctgtggccgatgtcg
cgcggcggctatccgaagcagtacctgaagctcgcgggcaacaccacgctcgtccagcag
accgcgctgcgcgtgcgcgatgtcgagggcgtcggcgcgccgatcgtcgtcacgaacaac
gagcagcgcttcctcgtcgccgaacagttgcgccaggtcggcatcacgccttcgtcgatc
gtgctcgagccgatgggccgcaacaccgcgcccgcgatcgcgattgccgccctcctcgcg
ctgcgcgagtcgcccgacgcgcttctgctcgtgctgccgtccgatcacgtgatcgataac
gaaaccgcattcgtcgacgtcgtgaagacggcggcgagcgtcgcgtccgacgcgcatctc
gtcacgttcggcgtcacgcccacgcaagcgcatacgggctacggctacattcgccgcggc
gaagcgttcgcgggcgacacgcgcgtctatcgcgtcgacgcattcgtcgagaagccggat
gcgccggcggccgagcgcttcatcgcggacggcggctattactggaacagcgggatgttc
atgctgaaggcatcgacgtatctcgacgagttgcgccgccacgcgcccgacatcgcgaac
caggccgagctcgcgctcggcgcggcaaagcgcgaccacgatttcctgcggctcgacccc
gaagcattcggcgcgagcccgaacgtgtcgatcgactacgcggtgatggagaagacggag
cgcgcagccgtcgtggccgccgcgaacctcggctggaacgacatcggctcgtggagcgcg
ctcgccgacatcgcggccaccgacgcgcagcgcaacgcgctgatcggcgacgtgtacacg
gacgcggtcgagaactcgtacatccgcgccgagcaccggatggtcgccgcgctcggcctc
gacaacatcgtgatcgtcgagaccgcggacgccgtgctcgtcgcgcatcgcgaccgcgcg
caagacgtgaagaaggtcgtcgaatggctgaatgcctcgggccgccgcgaatccgtcacg
catcgccgcgtgatccggccgtggggcgcgtacgaaggcatcgaccagggcgagcgcttc
caggtaaagcgcatcgtcgtcaatccgggcgcgcagttgagcctgcagatgcaccatcat
cgcgccgagcactggatcgtcgtgaagggcaccgcgctcgtcacgaacgacggcaaggag
atcatcctgaccgaaaatcagtcgacctacattccgctcggcacgacgcaccggctgaag
aatcccggcaagatcccgctcgagctgatcgaagtccagtccggctcgtatctcggcgaa
gacgacatcgtccgcttcgaggacacgtacggacgcacgtccgcgacctga

DBGET integrated database retrieval system