KEGG   Burkholderia thailandensis E444: BTJ_4195Help
Entry
BTJ_4195          CDS       T03112                                 

Definition
(GenBank) aminotransferase class-III family protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00860  Porphyrin and chlorophyll metabolism
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
btj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTJ_4195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btj01007]
    BTJ_4195
Enzymes [BR:btj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BTJ_4195
Amino acid related enzymes [BR:btj01007]
 Aminotransferase (transaminase)
  Class III
   BTJ_4195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHI82567
Position
2:1055798..1057156
Genome map
AA seq 452 aa AA seqDB search
MEIRHGVNLARARALAARERDAFERAMPKSRALSAEAAQHLLFGVPLHWMRDWSTPFSLY
VDHARGAHFTDVDGHRYADFCLGDTGAMFGHAPEPVARALADQAARGYTTMLPSADAAWV
GAELARRFRLPYWQFALSASDANRFVLRWARAATGRKHIVVFNGCYHGTVDDVFVDLVDG
RLVQRDSLLGQAHDLLAYTRVVEFNDLGTLEAALKDGDVACVLAEPALTNIGMVLPDPGF
WREARALIRRYGTLLAIDETHTISSGPGGYAVANGLEPDLLVVGKPIGGGVPCAVYGFSA
PFAERAQRAKASAPPGHSGIGTTLTANMLAMRAIRATLADVMTDAAYAHMFDLAARLAAG
LEQAIARRGLPWCVTRIGARTEFQFAPTPPRNGTIAGMQLDGELEHIVHLYLLNRGVLIT
PFHNMMLVCPETTAEDVDRLTAAFEACIGEMA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttggagattcgccacggagtgaacctcgcgcgcgcccgcgcgctcgccgcgcgcgaacgc
gacgcgttcgagcgggcgatgcccaaatcgcgcgcgctctcggccgaagctgcgcaacac
ttgctgttcggcgtgccgctgcactggatgcgcgactggtcgacgccgttctcgctgtac
gtcgatcacgcgcgcggcgcgcatttcaccgacgtcgacggccatcgctacgccgacttc
tgcctcggcgacacgggcgcgatgttcggccatgcgcccgaacccgtcgcgcgcgcgctc
gcagaccaggcggcgcgcggctatacgacgatgctgccgagcgcggacgccgcgtgggtg
ggcgccgagctcgcacgccgcttccggctgccgtactggcagttcgcgctgagcgcgagc
gacgcgaaccgcttcgtgctgcgctgggcgcgcgcggcgacgggccgcaagcacatcgtc
gtgttcaacggctgctatcacggcactgtcgacgacgtgttcgtcgatctcgtcgacggc
cggctggtgcagcgcgacagcctgctcggccaggcgcacgatctgctcgcgtacacgcgc
gtcgtcgagttcaacgatctcggcacgctcgaagcggcgctgaaggacggcgacgtcgca
tgcgtgctcgccgagccggcgctgacgaacatcggcatggtgttgcccgatcccggcttc
tggcgcgaggcgcgcgcgctgattcgccgctacggcacactgctcgcgatcgacgaaacc
catacgatcagcagcggccccggcggctacgcggtcgcgaacgggctcgagccggatctc
ctcgtcgtcggcaagccgatcggcggcggcgtgccgtgcgcggtatacggtttcagcgcg
ccgttcgccgagcgcgcgcagcgtgcgaaggcgagcgcgccgcccggccactccggcatc
ggcacgacgctgaccgcgaacatgctcgcgatgcgcgcgatccgcgcgacgctcgccgac
gtgatgacggacgccgcgtacgcacacatgttcgatctcgccgcgcggctcgccgccggg
ctcgaacaggcgatcgcgcggcgcgggctgccgtggtgcgtcacgcgcatcggcgcgcgc
accgaattccagttcgcgccgacgccgcctcgcaacggcacgatcgccggcatgcagctc
gacggcgagctcgagcacatcgtgcatctgtatctgctgaaccgcggcgtgctgatcaca
ccgttccacaacatgatgctcgtgtgcccggagacgacggcggaagacgtcgatcggctg
accgccgcgttcgaagcgtgcatcggcgagatggcctga

DBGET integrated database retrieval system