KEGG   Burkholderia thailandensis E444: BTJ_584Help
Entry
BTJ_584           CDS       T03112                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btj  Burkholderia thailandensis E444
Pathway
btj00280  Valine, leucine and isoleucine degradation
btj00310  Lysine degradation
btj00362  Benzoate degradation
btj00380  Tryptophan metabolism
btj00620  Pyruvate metabolism
btj00630  Glyoxylate and dicarboxylate metabolism
btj00640  Propanoate metabolism
btj00650  Butanoate metabolism
btj00900  Terpenoid backbone biosynthesis
btj01100  Metabolic pathways
btj01110  Biosynthesis of secondary metabolites
btj01120  Microbial metabolism in diverse environments
btj01130  Biosynthesis of antibiotics
btj01200  Carbon metabolism
btj01212  Fatty acid metabolism
btj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTJ_584
   00630 Glyoxylate and dicarboxylate metabolism
    BTJ_584
   00640 Propanoate metabolism
    BTJ_584
   00650 Butanoate metabolism
    BTJ_584
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTJ_584
   00072 Synthesis and degradation of ketone bodies
    BTJ_584
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTJ_584
   00310 Lysine degradation
    BTJ_584
   00380 Tryptophan metabolism
    BTJ_584
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTJ_584
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTJ_584
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTJ_584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btj04147]
    BTJ_584
Enzymes [BR:btj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTJ_584
Exosome [BR:btj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTJ_584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHI80311
Position
1:652633..653811
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWRGAFNMTHGATLGGHVVAAAVARAKLDPARVEDVLIGCANPE
GATGANIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESI
SCVQNEMNRHMLREGWLDAHKPEIYWSMLQTAENVAKRYGIAKERQDEYGVNSQLRAAAA
QAAGRFDAEIVPITVRAGVADKATGRLYTKDVTLAADEGIRPDTTLEGVAKIRSALPGGV
ITAGNASQFSDGAAACVVMNAKLAEREGLAPLGIFRGFAVAGCEPDEMGIGPVYAVPKLL
KQAGLKVSDIDLWELNEAFAVQVLYCRDTLGIPDDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcacggggctcgcgaaatcctggcgcggc
gcgttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggccgccgtcgcg
cgcgcgaagctcgatcccgcgcgcgtcgaggacgtgctgatcggctgcgcgaatcccgag
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgctgcgcgcggggttgcccgtcagc
gtgccggggatgaccgtcaaccgtttctgctcgtcgggattgcagacgatcgcgctcgcc
gcgcagcgcgtgatcgcgggcgagggcgacgtgttcgtcgcgggcggggtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccggcacatgctgcgcgagggctggctcgacgcgcac
aagccggagatctactggtcgatgctgcagacggccgagaacgtcgcgaagcgctacggc
atcgcgaaggagcgccaggacgagtacggcgtgaattcgcagcttcgcgcggcggccgcg
caggccgcggggcgattcgacgcggagatcgtgccgatcaccgtgcgcgcgggcgtcgcc
gacaaggcgacgggccgtctctacacgaaggacgtgacgctcgccgccgacgagggcatt
cggcccgacacgacgctcgaaggcgtcgcgaagatccgctcggcgctgccgggaggcgtg
attaccgcgggcaacgcgagccagttctcggacggcgcggccgcgtgcgtcgtgatgaac
gcgaagctcgccgagcgcgagggcctcgcgccgctcggcattttccgcggtttcgcggtg
gccggctgcgagccggacgagatgggcatcgggcccgtctacgcggtgccgaagctgttg
aagcaggcggggctcaaggtgtccgacatcgatctgtgggagctgaacgaggcgttcgcg
gtgcaggtgctctattgccgcgacacgctcgggattcccgacgatcggctgaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggcgtgtcgggcgcgcggctcacgggccat
gcgctgatcgagggcaagcggcgcggcgcgaaatacgtggtcgtgacgatgtgcatcggc
ggcgggcagggcgcggcgggattgttcgaggtggtgtga

DBGET integrated database retrieval system