KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1141Help
Entry
BT9727_1141       CDS       T00179                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00260  Glycine, serine and threonine metabolism
btk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01130  Biosynthesis of antibiotics
btk01230  Biosynthesis of amino acids
Module
btk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT9727_1141 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BT9727_1141 (trpB)
Enzymes [BR:btk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BT9727_1141 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 2855064
NCBI-ProteinID: YP_035477
UniProt: Q6HLU4
Position
1230748..1231941
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaaca
ccgctttatttcgctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaattggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggt
gttgcaacagctacggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaa
gaagatgtgagacgtcaaaaattaaatgtgtttcgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacacgtgcatgatacgcactacattatgggatctgttctcggaccgcatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattgggaatgagacgaaaaaacaatat
gaagcgttagaaggaaagttaccagaagcagtcgttgcttgcattggtggtgggagtaac
gcaatgggaatgttttatccgtttgtacatgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggcgttttacacggatcgatgatgtatcttctgcaaaatgaagaaggacaaattcaagaa
gcgcactctatttcagcaggacttgattacccaggtgttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaggcgttagaagcgttt
cagttattaacgaaaaaagaagggattatcccggcgttagaaagctcgcatgctgtcgca
tacgcattaaaattagcgccgcaaatgaaggaagatgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttacatggaagaggtgtaa

DBGET integrated database retrieval system