KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1335Help
Entry
BT9727_1335       CDS       T00179                                 

Gene name
pit
Definition
(RefSeq) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Brite
KEGG Orthology (KO) [BR:btk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BT9727_1335 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Cnd3
Motif
Other DBs
NCBI-GeneID: 2857019
NCBI-ProteinID: YP_035669
UniProt: Q6HLA2
Position
complement(1414151..1415149)
Genome map
AA seq 332 aa AA seqDB search
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIVMAAIMNFLGAMTF
TGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAI
AAAGISSLNLKGFIKIIEALIISPIIAFVIGYTVYSIFKVVFKNFNLTKTNKNFRIFQIF
TAALQAYTHGTNDAQKAMGIITMALMANNYHTSSDIPFWVQLSCAIAMGLGTSVGGWKII
KTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKW
GTAKRMLITWVITLPISASLAALFYSLLHLIF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacactcttgatactgaccgttttagtagtcatttgcgctttagcttttgacttt
atcaatggttttcacgatacagcaaacgctattgcaacggctgtttcaacgaaagcccta
aagcctagacatgccattgttatggcggctattatgaactttttaggtgcaatgacattt
acaggtgtagcaaaaacgattacaaaagatatcgttgatccattcgccttacaaaatggt
tctcttgtaattttagctgctttgcttgcagcaatagcttggaacttaattacttggtac
tacggtattccaagtagttcttcgcatgcaattatcggctcaatcgcaggtgcagcaatt
gctgccgctgggattagctcgctaaatcttaaaggattcattaaaattattgaagcttta
atcatttcaccaattatcgctttcgttattggttataccgtatacagtatttttaaagta
gtatttaaaaactttaacttaacgaaaacgaataagaatttccgtatattccagattttc
actgctgcattacaggcttatacacatggtacgaatgatgcgcaaaaagcaatgggaatc
attacgatggctcttatggctaataactatcatacttcgagcgacatcccgttctgggta
caattatcttgtgcaattgcaatgggtcttggtacttctgtcggcggatggaaaattatt
aaaactgtcggtgggcaaatcatgaaaattcgtcctgtaaatggtgtagctgctgattta
tcatcatctcttgttattttcggggcaacatttattcacttaccagttagtacgacgcac
gttatctcctcttctattttaggggttggtgcttctcatcgtgtaaaaggtgtaaaatgg
ggaactgcaaaacgcatgttaattacttgggttatcacacttcctatttcagcttcatta
gctgctttattttactctttattacacttaatcttttaa

DBGET integrated database retrieval system