KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1580Help
Entry
BT9727_1580       CDS       T00179                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00010  Glycolysis / Gluconeogenesis
btk00260  Glycine, serine and threonine metabolism
btk00680  Methane metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01200  Carbon metabolism
btk01230  Biosynthesis of amino acids
Module
btk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btk_M00002  Glycolysis, core module involving three-carbon compounds
btk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_1580 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BT9727_1580 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT9727_1580 (gpm)
Enzymes [BR:btk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BT9727_1580 (gpm)
Membrane trafficking [BR:btk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BT9727_1580 (gpm)
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BT9727_1580 (gpm)
  Exosomal proteins of melanoma cells
   BT9727_1580 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 2857708
NCBI-ProteinID: YP_035912
UniProt: Q6HKL4
Position
1655313..1655888
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERGRPLSEKGHCDAENVTSLLKDKHIDVVISSPYKRAIQTVQG
IANTYHVSIEIEEDLRERLLSSEPVADFNDAIENVWEDWSFAYEGGESNDVAQRRAVICM
QSILKKYKGKNIVIGTHGNIMVLLMNYFDSKYDFRFWKTLRMPDIFKLNFHNEDLVSAER
IENTGHQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagagcggggg
cgtcctttatctgaaaaagggcactgtgatgcagaaaacgttacgagcttattaaaagat
aaacacattgatgtagtgatttctagcccgtacaaaagagcaattcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaagatttacgagaaaggttatta
agttcagaaccagtagcagattttaatgatgctatcgagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatcaaatgatgtagcacaaagacgcgctgtaatatgtatg
caaagtatattaaaaaaatataaaggtaaaaatattgtaataggtacgcatgggaatatt
atggtattacttatgaattattttgattcaaaatatgattttcgattttggaaaacactt
cgtatgcccgatatatttaagttgaattttcataatgaagatttagtttctgccgaaagg
atagagaatacgggtcatcagataaataatttgtaa

DBGET integrated database retrieval system