KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1966Help
Entry
BT9727_1966       CDS       T00179                                 

Definition
(RefSeq) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00860  Porphyrin and chlorophyll metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BT9727_1966
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BT9727_1966
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BT9727_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 2-Hacid_dh_C TrkA_N Pyr_redox Sirohm_synth_M XdhC_C Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 2857858
NCBI-ProteinID: YP_036295
UniProt: Q6HJI1
Position
complement(2044785..2045258)
Genome map
AA seq 157 aa AA seqDB search
MYNMYPLMFNLHNKVVVIIGGGKIAYRKASGLKDTGAFVTVVSPEICKEMKELPYITWKQ
KTFSNDDIKDAHLIYAATNQHAINMMVKQAAHDFQWVNVVSDGTESSFHTPGVIRNGEYV
VTISTSGKDPSFTKRMKQELTSIFPTLIKKLSRTHKL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtataacatgtaccctctcatgtttaatctacataataaagtggtcgttatcattggt
ggaggtaaaatcgcatatcgaaaagcgtctggattaaaagatacaggcgcttttgtcacc
gttgtcagcccagaaatttgcaaggaaatgaaggaacttccttatattacttggaagcaa
aaaacttttagtaatgatgatattaaagatgctcatcttatttatgcagctacaaatcaa
catgctataaatatgatggtcaaacaggccgcccatgattttcaatgggttaacgttgta
agtgacggtacagaatcatcgtttcacacaccgggtgtcatccgaaatggtgaatatgtt
gtaacgatttcaacttcaggtaaagatccatcttttacgaagcgtatgaagcaggaacta
acatctatttttcctactcttataaaaaagctttctcgtactcacaaattataa

DBGET integrated database retrieval system